(data stored in ACNUC1104 zone)

EMBL: CP002026.PE170

CP002026.PE170       Location/Qualifiers
FT   CDS_pept        165987..166451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll3994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87507"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z7"
FT                   /inference="similar to AA sequence:KEGG:bll3994"
FT                   /protein_id="ADH87507.1"
FT                   /translation="MQNKANHEPTTAERRFIEDTARLLVPWGVPQTAARLYGFLLIHAK
FT                   PVSLDAIAEGLEISKSSASVAARLLEKYTLAHRHGVRGSKRALYGVSDNYAAMLAEQNR
FT                   LLDALAALMRSGARGVRSEGARDRLTEMADFYAAIRQGMEATLARLRAKE"
     atgcagaata aagcaaatca cgagccgacg accgccgagc gccgcttcat cgaggatacg        60
     gcacggctgc tggtgccctg gggggtgccg caaacggcgg cgcggctcta cggcttcctg       120
     ctcatccatg caaagccggt gagcctcgat gccatcgccg aggggctgga gatcagcaag       180
     agcagcgcca gcgtcgccgc ccggctgctg gagaaataca cgttggcaca tcgccacggc       240
     gtgcgcggca gcaagcgggc gctctacggc gtgtccgaca attacgcggc catgctggcc       300
     gagcagaacc gcctcctcga cgcgctggcc gcgctgatgc gctccggtgc gcgcggtgtc       360
     cggtcagaag gcgcgcgcga tcgcctcacc gagatggccg atttctatgc ggcgatacgc       420
     cagggcatgg aggcgacgct ggcccgcctg cgggcgaagg agtag                       465
//

If you have problems or comments...

PBIL Back to PBIL home page