(data stored in ACNUC1104 zone)

EMBL: CP002026.PE171

CP002026.PE171       Location/Qualifiers
FT   CDS_pept        complement(166481..167734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0172"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="TIGRFAM: amidase, hydantoinase/carbamoylase family;
FT                   KEGG: mrd:Mrad2831_5813 allantoate amidohydrolase; PFAM:
FT                   peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87508"
FT                   /db_xref="GOA:D7A0Z8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z8"
FT                   /inference="protein motif:TFAM:TIGR01879"
FT                   /protein_id="ADH87508.1"
FT                   /translation="MSPLAKAIALTEQLFEELRAHTTDEPGITRAAYGEGEEFAHAVVR
FT                   RVGRELGLNEAVDAAGNLYLTLEGEDPTLPSWIIGSHIDSVPHGGNYDGAAGVFAGLAL
FT                   VHALRTEGRRLTRNLTIMVIRAEESTWFPVSYLGSRAAFGLLPADALETRRADTGLTLR
FT                   EHMAALGLNPDAVARGETYLDPASIHGFVEVHIEQGPVLEREDAPIGLVTGIAGSFRYR
FT                   KGRVLGQYGHSGAVPRAYRQDAVIGFADLVAALETTWDGLERDGERATITFGEVGTDPT
FT                   QHAFSKVPGEVGFCLDVRSESPMVLERIHAELFAHAAIIEQRRGVRFDFGEQSGSTPAV
FT                   LDAGQRAGLKAAAACEGIRAIEMPSGAGHDTATFAGRGVPASLIFVRNQNGSHNPFEAM
FT                   RIEDFACAVRTLLSFLKV"
     atgagcccgc tcgccaaggc catcgccctc accgagcagc tcttcgagga gctgcgcgcc        60
     cacaccaccg acgagccagg catcacccgc gccgcctatg gcgagggcga ggagttcgcc       120
     catgcggtgg tccggcgcgt cggccgcgaa ctcggcctaa acgaagccgt cgacgccgcc       180
     ggcaatctct atctgacgct ggagggcgag gatccgacgc tgcccagctg gatcatcggc       240
     tcgcatatcg acagcgtgcc gcatggcggc aattacgacg gcgccgccgg tgtgttcgcc       300
     gggctcgccc tggtgcatgc gctgcgcacg gaaggccggc ggctcacgcg caacctcacc       360
     atcatggtca tccgcgccga ggagagcacc tggttcccgg tctcctatct cggcagccgc       420
     gccgccttcg gcctcctgcc ggccgacgcg ctggagacgc ggcgcgccga caccggcctg       480
     acgctgcgcg agcacatggc cgccctcggc ctaaatcccg acgcggtggc gcgcggcgaa       540
     acgtatttag accccgccag catccacggc ttcgtcgagg tgcatatcga gcaggggccg       600
     gtgctggagc gcgaggatgc gcccatcggc ctcgtcaccg gtattgccgg ctcgttccgc       660
     taccgcaagg gccgcgtgct cggccagtac ggccattccg gcgccgtgcc gcgcgcctat       720
     aggcaggacg cggtgatcgg cttcgccgat ctcgtcgccg cgctggagac cacatgggac       780
     gggctggagc gcgacgggga acgcgccacc atcaccttcg gcgaggtcgg caccgacccg       840
     acccagcatg ccttctccaa ggtgccgggc gaggtcggct tctgcttgga cgtgcgcagc       900
     gagagcccaa tggtgctgga gcgcatccat gccgagcttt tcgcccatgc cgccatcatc       960
     gagcagcggc gcggcgtgcg cttcgacttc ggcgagcagt ccggcagcac gcccgccgtg      1020
     ctcgatgccg gccagcgtgc cgggctgaag gcggcggcgg cctgcgaggg catccgcgcc      1080
     atcgagatgc cgagcggcgc cggccacgac accgcaacct tcgccgggcg cggcgtgccg      1140
     gcgagcctca tcttcgtgcg caaccagaac ggcagccaca acccgtttga agccatgcgg      1200
     atcgaggact tcgcctgcgc ggtgcggacg ctgctgtcgt tcctgaaggt ctag            1254
//

If you have problems or comments...

PBIL Back to PBIL home page