(data stored in ACNUC1104 zone)

EMBL: CP002026.PE172

CP002026.PE172       Location/Qualifiers
FT   CDS_pept        complement(167731..168720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0173"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: mrd:Mrad2831_4405 D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87509"
FT                   /db_xref="GOA:D7A0Z9"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A0Z9"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADH87509.1"
FT                   /translation="MSSLCLILQRIHDAGVEHLLAAGHEVRLATSLEPGALLAEIAPAR
FT                   AVLTRDARVDGPLMDAAPDLKVIGVHGAGVDNVDIAAATARGIPVVNTPGANARSVAEH
FT                   ALALAFHLAKALGPGERAARASDGSFKYRARMIELDGAVFGLVGFGAIGRETGRLARAL
FT                   GMEVIVWTRRPDDPAVAAAGFTHVADLNELLARADIVSLHLPGGAQTRHLIGAPELARM
FT                   KDTAYLINTARGTIIDEAALVEALREGRIAGAGLDVFETEPMPPSSPLIGFDNVVLSPH
FT                   VGGSTQAALRRTAVALAEQVNDVLAGRRPAHLVNPEVWPIAAIAEAGA"
     gtgagctcgc tctgcctcat cctccagcgc atccacgacg ccggcgtcga gcatcttctc        60
     gccgccggcc acgaggtccg cctcgctacc tcgctggagc ctggggcgct gctcgcggag       120
     atcgcccccg cccgcgccgt gctgacccgc gatgcgcgcg tcgacgggcc gctgatggac       180
     gcggcacccg atctcaaggt gatcggcgtg cacggtgccg gcgtcgacaa tgtcgacatc       240
     gccgccgcca ccgcgcgcgg catcccggtg gtgaacacgc ccggcgccaa tgcccgctcg       300
     gtggccgagc acgcgctggc gctggcgttc catctcgcca aggcgctcgg ccccggcgag       360
     cgtgccgccc gcgccagcga cggctcgttc aagtaccgcg cgcggatgat cgagctcgac       420
     ggtgccgtct tcggcctcgt cggcttcggc gccatcggcc gcgagaccgg gcgcctcgcc       480
     cgcgcgctcg gcatggaggt gatcgtctgg acccgccgcc cggacgatcc cgcggtcgcg       540
     gcggccggct tcacccatgt cgccgacctg aacgagctgc tggcacgggc cgacatcgtc       600
     tcgttgcacc tgccgggcgg ggcgcagacg cgccatctga tcggcgcacc tgagctcgcc       660
     cgcatgaagg acaccgccta cctcatcaac accgcgcgcg gcacgatcat cgacgaggcg       720
     gcgctcgtcg aggcactgcg cgagggtcgc atcgccggcg ccgggctcga cgtgttcgag       780
     accgagccga tgccgccctc gtcgccgctc atcggcttcg acaatgtggt gctcagcccg       840
     catgtcggcg gctcgacgca ggccgcgctg aggcgcacgg cggtcgccct cgccgagcag       900
     gtgaacgacg tccttgccgg ccgccgcccg gcccatctcg tcaatcccga ggtctggccg       960
     atcgcggcga tcgcggaggc cggcgcatga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page