(data stored in ACNUC1104 zone)

EMBL: CP002026.PE173

CP002026.PE173       Location/Qualifiers
FT   CDS_pept        complement(168734..169513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0174"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rsp:RSP_3440 putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87510"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A100"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87510.1"
FT                   /translation="MDLGLKGRTALVLGANRGLGNAIARTLAKEGAAVILAGRNEAALE
FT                   EEAAAIRKDGGEARIQKLDLGDRASVLAALDVLEGETIDILVNNSGGPPPGPVAAVTPD
FT                   VWSAQFETMVSAIFLVTSRLLPGMRARKFGRIVNIASSGVTQPIPNLGISNALRASIIG
FT                   WAKTLAAEVAADGVTVNSVLPGRIHTQRTDQIDAANAARSGQSVDQVSAASRATIPMGR
FT                   YGTPQEFADVVAFLASERASYVTGSTLRVDGGAIRSI"
     atggatctcg gactgaaggg ccgcaccgcg ctggtgctcg gcgccaatcg cggcctcggc        60
     aacgccatcg cccgcacgct cgccaaggaa ggcgcggcgg tgatcctcgc cggccgcaac       120
     gaggcggcgc tggaggaaga agccgccgcc atccgtaagg acggcggcga ggcgcgcatc       180
     cagaagctgg atctgggcga ccgcgcctcg gtgctggccg cgctcgatgt gctcgaaggc       240
     gagacgatcg acatcctcgt caacaattcc ggcggcccgc cgcccggccc ggtcgcggcc       300
     gtgacgccgg acgtatggag cgcgcagttc gagacgatgg tgagcgccat cttcctcgtc       360
     acctcgcggc tgctgccggg catgcgggcg aggaagttcg gccgcatcgt caacatcgcc       420
     tcctccggtg tcacccagcc gatcccgaac ctcggcatct ccaacgcgct gcgcgcctcc       480
     atcatcggct gggccaagac gctggccgcg gaggtggcgg cggacggggt gacggtgaac       540
     tcggtgcttc cggggcgcat ccatacccag cgcaccgacc agatcgacgc cgccaacgcc       600
     gcccgcagcg gccagagcgt cgaccaggtg tcggccgcct cgcgcgcgac cattccgatg       660
     gggcgctacg gcacgccgca ggaattcgcc gacgtggtgg ccttcctcgc cagcgagagg       720
     gccagctacg tcaccggctc gacgctgcgc gtcgacggcg gcgccatccg cagcatttaa       780
//

If you have problems or comments...

PBIL Back to PBIL home page