(data stored in ACNUC1104 zone)

EMBL: CP002026.PE175

CP002026.PE175       Location/Qualifiers
FT   CDS_pept        complement(170468..171148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0176"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: mrd:Mrad2831_5808 GntR family transcriptional
FT                   regulator; PFAM: GntR domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87512"
FT                   /db_xref="GOA:D7A102"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A102"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADH87512.1"
FT                   /translation="MSVPVRRKAVADPLEEREESLSQMAYNALLDQLIKREIPVGSVLQ
FT                   ERRLAEALAISRTPVRDALNRLESEGFITRKPGGVLVVKEFSTRELIETLHVRQILETE
FT                   GARLATGRIPVAELDEVEAEIRALLAAPAPNAEKDWEVDCRFHSMIAARSGNAVLAKHI
FT                   HDLRLKTHMFNMDRVPERFEIGHREHLSIIDALRREDREAARAGLYAHIENVKLSIIEK
FT                   LRAI"
     atgtccgttc ccgtccgacg caaggctgtg gccgacccgc tcgaagagcg cgaggaaagc        60
     ctcagccaga tggcctacaa cgcgctgctg gaccagctga tcaagcgcga gattccggtc       120
     ggctcggtgc tgcaggaacg ccgcctcgcc gaggcgctcg ccatctcccg caccccggtg       180
     cgcgacgcgc tcaaccgctt ggagagcgaa ggcttcatca cccgcaagcc cggcggcgtg       240
     ctggtggtga aggagttctc cactcgcgag ctgatcgaga cgctgcatgt gcgccagatc       300
     ctggagaccg aaggcgcgcg cctcgccacc gggcgcattc ccgtcgccga gctcgacgag       360
     gtcgaggccg agatccgcgc tttgctcgcc gctcccgcgc cgaacgccga gaaggattgg       420
     gaggtcgact gccgcttcca ctccatgata gccgcccgca gcggcaatgc ggtgctcgca       480
     aagcacatcc acgacctgcg gctgaagacg cacatgttca acatggaccg cgtgcccgag       540
     cgcttcgaga tcggccatcg cgaacatctt tccatcatcg acgcgctgcg ccgggaggac       600
     cgcgaggccg cccgcgccgg cctctacgcc catatcgaga acgtaaagct gagcatcatc       660
     gagaagctcc gcgccatctg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page