(data stored in ACNUC1104 zone)

EMBL: CP002026.PE176

CP002026.PE176       Location/Qualifiers
FT   CDS_pept        complement(171223..172023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0177"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: ara:Arad_7980 amino acid ABC transporter;
FT                   PFAM: extracellular solute-binding protein family 3; SMART:
FT                   extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87513"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D7A103"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADH87513.1"
FT                   /translation="MRLNLLPVLAAALVGGLVTGGLSAPANAQQLELVKPGALLVATEG
FT                   TYPPFSMRTPDGQLDGLEIRVAKEIARRLNLTYEPVVIKWEALLVGLAADQYDFASAAM
FT                   DITAERQKQVMFADGWLESGGRVVTQKGSPIKTPADIKGKTVGVLVSSTWQKLAEERGA
FT                   TVKAYKAESDAIQDLVNGQIDAVITDSIAAAYAIEASKLPLVMVDDYLSHIQKGFPFKK
FT                   GKPNLVKAVNKALADMIADGTYAKLTTPLIGYSPAPKDPIKTIF"
     atgcgtctga atcttcttcc cgtgcttgcc gccgctctcg tcggcggcct cgtcaccggc        60
     gggctctcgg ccccggcgaa cgcccagcag ctcgaactcg tcaagcccgg cgcgctgctc       120
     gtcgccaccg aaggcaccta cccgcccttc tccatgcgca cgccggatgg ccagctcgac       180
     gggctggaaa tccgcgtcgc caaggagatc gcgcggcggc tgaacctcac ctatgagccg       240
     gtcgtcatca aatgggaggc gctgctcgtc ggcctcgccg ccgaccagta cgacttcgcc       300
     tccgctgcca tggatattac cgccgagcgc cagaagcagg tgatgttcgc cgatggctgg       360
     ctggaatcgg gcggccgcgt cgtcacccag aagggctcgc cgatcaaaac gcccgccgac       420
     atcaagggca agacggtcgg cgtgctggtc tcctccacct ggcagaagct ggccgaggag       480
     cgcggcgcga cggtgaaggc ctacaaggcc gaatccgatg ccatccagga tctggtgaac       540
     ggccagatcg acgcggtgat caccgattcg atcgccgctg cctacgccat cgaggcgtcc       600
     aagctgccgc tggtgatggt cgacgactat ctcagccaca tccagaaggg cttccccttc       660
     aagaagggca agccgaacct ggtcaaggcg gtgaacaagg cgctggcgga catgatcgcc       720
     gacggcacct atgccaagct caccaccccc ctgatcggct actcgcccgc tcccaaggat       780
     ccgatcaaga cgatcttctg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page