(data stored in ACNUC1104 zone)

EMBL: CP002026.PE177

CP002026.PE177       Location/Qualifiers
FT   CDS_pept        complement(172122..173066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0178"
FT                   /product="agmatinase"
FT                   /note="KEGG: rsp:RSP_3743 agmatinase; TIGRFAM: agmatinase;
FT                   PFAM: Arginase/agmatinase/formiminoglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87514"
FT                   /db_xref="GOA:D7A104"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:D7A104"
FT                   /inference="protein motif:TFAM:TIGR01230"
FT                   /protein_id="ADH87514.1"
FT                   /translation="MSVLPIDSLETPRFCGVPTFMRLPQATTLKGLDAAIIGLPSDSGA
FT                   PFRTGARFAPNAVRAMSIMLRPINPYRNINVFERLACADAGDAAVVPGYEIESLERLEL
FT                   AVRAVVDAGVTPFGIGGDHSVTLAGLRAVAAKHGPLALIQFDSHSDTWDKYFAGQRYSA
FT                   GTPFRRAVEEGIVDPARSIQIGLRGSLFKPDDVSQSVELGFEVVTTDGMFEMGIPALAA
FT                   RIAERTGSHPAYLTFDLDFVDPAYAPAVETPEAGGPSAREALDLLRRIEGVNLVGADVV
FT                   ELCPPYDGSSQISALLAATVMAELLALKASTES"
     atgagcgtcc tgcccatcga ctcgctggaa accccgcgtt tctgcggcgt gccgaccttc        60
     atgcgcctgc cgcaggcgac gacgctgaag ggcctcgacg cggcgatcat cggcctgccc       120
     tcggattccg gtgcgccctt ccgcaccggc gcgcgcttcg cgcccaatgc cgtgcgcgcc       180
     atgtcgatca tgctgcggcc gatcaacccg taccggaaca tcaacgtctt cgagcgcctc       240
     gcctgcgccg atgccggaga cgcggcggtc gtgcccggct atgagatcga gtcgctggag       300
     cggctggagc tggcggtgcg cgccgtggtc gatgccggcg tcacgccctt cggcatcggt       360
     ggcgatcatt cggtgacgct ggcggggctg cgcgcggtcg ccgccaagca cgggccgctg       420
     gcgctgatcc agttcgattc ccactccgac acctgggaca agtacttcgc cgggcagcgc       480
     tacagcgccg gcacgccgtt ccgccgcgcg gtggaggaag gcatcgtcga ccccgcgcgc       540
     tcgatccaaa tcggcctgcg cggttcgctg ttcaagccgg acgatgtcag ccagtcggtc       600
     gagctcggct tcgaggtcgt caccaccgat ggcatgttcg agatgggcat cccggcgctc       660
     gccgcccgca tcgcggagcg caccggcagc cacccggcct acctcacctt cgacctcgac       720
     ttcgtcgacc cggcctatgc gcccgcggtg gagacgccgg aggccggcgg ccccagcgcg       780
     cgcgaggcgc tggacctcct gcgacggatc gaaggcgtca acctcgtcgg cgccgacgtg       840
     gtcgagctct gcccgcccta tgacggctcc agccagatct cggcgctgct cgccgccacg       900
     gtcatggccg agcttctggc gctcaaggcg agtacggaat cctga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page