(data stored in ACNUC1104 zone)

EMBL: CP002026.PE178

CP002026.PE178       Location/Qualifiers
FT   CDS_pept        complement(173079..173747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0179"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: rsh:Rsph17029_3475 polar amino acid ABC
FT                   transporter, inner membrane subunit; TIGRFAM: polar amino
FT                   acid ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87515"
FT                   /db_xref="GOA:D7A105"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A105"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADH87515.1"
FT                   /translation="MIEKIAVWWEGFAPYVPGFLAASWLVLVLSLLAILVSWGCGLIAA
FT                   LGKVSRFAALRKASEFYIWFIRGTPTLIQIFIIYFGLPQLGLRLSPFVAGVVALGFNGG
FT                   AYVAEIVRAGLSAIPKGQTESAQALGMGRWQMMTRIILPQVFRVILPPVTNEAITMVKN
FT                   TSLLSTITVVELTLYSQTIIATTFRPFEFYIATALIYLVMTSLISQAAAHAERHYARSL
FT                   "
     atgatcgaga agatcgccgt ctggtgggaa ggcttcgccc cctatgtgcc cggcttcctc        60
     gccgcgagct ggctggtgct ggtgctctcg ctgctggcca tattggtgag ctggggctgc       120
     gggctgatcg ccgcgctcgg caaggtgtcg cgcttcgccg cgctgcgcaa ggcgagcgaa       180
     ttctacatct ggttcatccg cggcacgccg acgttgatcc agatcttcat catctatttc       240
     ggcctgccgc agctggggct tcggctctcg cccttcgtcg ccggcgtggt cgcgctcggc       300
     ttcaatggcg gcgcctatgt cgccgagatc gtgcgcgccg gcctctccgc cattcccaag       360
     gggcagacgg aatcggcgca ggcgctcggc atgggtcgct ggcagatgat gacccgcatc       420
     atcctgccgc aggtcttccg cgtgatcctt ccgcccgtga ccaacgaggc gatcaccatg       480
     gtgaagaaca cctcgctgct ctccaccatc accgtggtcg agctgacgct ctactcgcag       540
     accatcatcg ccacgacgtt ccgccccttc gaattctaca tcgcgaccgc gctcatctac       600
     ctggtgatga cctcgctcat ctcgcaggcg gcagcgcatg ccgagcggca ctacgcccgc       660
     tcgctgtaa                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page