(data stored in ACNUC1104 zone)

EMBL: CP002026.PE179

CP002026.PE179       Location/Qualifiers
FT   CDS_pept        complement(173744..174553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0180"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: mrd:Mrad2831_5811 ABC transporter related;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87516"
FT                   /db_xref="GOA:D7A106"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D7A106"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87516.1"
FT                   /translation="MDGEPLIRIRDLRKSFGAHEVLKGVSLDVHAGEVVSIIGASGSGK
FT                   STFLRCINVLEKPTGGTMDFGGFHFDYEQGARLQPTAAQLRELRARIGMVFQSYNLWPH
FT                   MTVLENVIEAPIRVKGETPAEARDKAEALLARIGLAEKRHAYPSKLSGGQQQRVAIVRA
FT                   LAMQPKLMLFDEVTSALDPELVGEVLSLMASLAAEGMTMLLVTHEIGFAREVSNRVIFF
FT                   DQGVIAEDGHPREVLRQPRSERLQQFLRRVLHEDAYHAAPLTEGAAS"
     atggacggcg agccgctgat ccgcatccgc gatttgcgca agagcttcgg cgcccatgag        60
     gtgctgaagg gcgtgtccct cgacgtgcat gccggcgagg tggtctcgat catcggcgcc       120
     tcgggctcgg gcaagagcac cttcctgcgc tgcatcaacg tgctggagaa gcccaccggc       180
     ggcacgatgg atttcggcgg cttccacttc gactacgagc agggcgcccg cctccagccg       240
     accgcagcgc agctgcgcga attgcgcgcc cgcatcggca tggtgttcca gagctacaat       300
     ctctggccgc acatgaccgt gctggagaac gtcatcgagg caccgatccg ggtgaagggc       360
     gagacgcccg ccgaggcgcg cgacaaggcc gaggcgctgc tcgcccgcat cggcctcgct       420
     gagaagcgcc acgcctatcc ctccaagctc tccggcggcc agcagcaacg cgtcgccatc       480
     gtgcgcgcgc tcgccatgca acccaaactg atgctgttcg acgaggtcac ctcggcgctc       540
     gatccggagc tggtcggcga ggtgctctcg ctgatggcga gcctcgctgc cgagggcatg       600
     accatgctgc tggtcaccca cgagatcggc ttcgcccgcg aggtctccaa ccgggtgatc       660
     ttcttcgacc agggcgtcat cgccgaggac gggcacccgc gcgaggtgct gcgccaaccc       720
     aggagcgagc ggctgcagca gttcctgcgc cgcgtgctgc acgaggatgc ctatcacgcc       780
     gcgccgctca ccgaaggggc cgcatcatga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page