(data stored in ACNUC1104 zone)

EMBL: CP002026.PE181

CP002026.PE181       Location/Qualifiers
FT   CDS_pept        175542..176282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0182"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="KEGG: mrd:Mrad2831_5815 allophanate hydrolase
FT                   subunit 1; PFAM: Allophanate hydrolase subunit 1; SMART:
FT                   Allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87518"
FT                   /db_xref="GOA:D7A108"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D7A108"
FT                   /inference="protein motif:PFAM:PF02682"
FT                   /protein_id="ADH87518.1"
FT                   /translation="MKTGPAPAPRLLDAGESGLVVEFGDAIDETINRQVIALADALAAR
FT                   ELAGVREVVPTYRSLLVLFDPLVLAREDLREEVLALWPPPADAGEAHGIWRVPVLYGGE
FT                   HGVDLEHVAHVHGLTTQEVIDLHSGADYRVYMIGFAPGFAYLGGLPEAVHTSRRTGPRM
FT                   GTPPRSVSIGGKQTAVSPPLSIPSAWHLLGQTPVRSYDPARAERPFLFAAGDTIRFVPI
FT                   KAGEYERLCRAAEAGEIVAEWEPA"
     atgaagaccg ggccggctcc cgccccccgc ctgctcgacg ccggggagag cggcctcgtc        60
     gtcgagttcg gcgacgccat cgacgagacc atcaatcggc aggtgatcgc cctggcggat       120
     gcgctggcgg cgcgcgagct tgccggcgtg cgcgaggtgg tgccgaccta tcgctcgctg       180
     ctggtgctgt tcgacccgct agtgctggcg cgcgaggacc tgcgcgaaga ggtgctggcg       240
     ctctggccgc cgccggcgga tgccggcgag gcccacggca tctggcgcgt gccggtgctc       300
     tatggcggcg agcatggcgt cgacctcgag catgtcgcgc atgtgcacgg tctcaccacg       360
     caggaggtga tcgacctgca cagcggcgcc gactatcgcg tctacatgat cggcttcgcg       420
     ccgggcttcg cctatctcgg cggcctgccg gaggcggtcc acaccagccg gcgtaccggc       480
     ccgcggatgg gaacgccgcc gcgtagcgtc tccatcggcg gcaagcagac ggccgtctcg       540
     ccgccgctgt cgattccctc ggcctggcac ctgctcggcc agacgccggt gcgctcctat       600
     gatcctgcgc gcgccgagcg tccgttcctg ttcgcggcgg gcgacaccat ccgtttcgtg       660
     cccataaagg cgggggaata tgagcgcctg tgccgagcgg ccgaggcggg cgagatcgtc       720
     gccgaatggg agccagcgtg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page