(data stored in ACNUC1104 zone)

EMBL: CP002026.PE183

CP002026.PE183       Location/Qualifiers
FT   CDS_pept        177333..178103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0184"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG:
FT                   mrd:Mrad2831_5814 LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87520"
FT                   /db_xref="GOA:D7A110"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D7A110"
FT                   /inference="protein motif:PFAM:PF03746"
FT                   /protein_id="ADH87520.1"
FT                   /translation="MKTIDLNCDMGEGFGVYSLGDDKAMLDIVTSANIACGFHAGDPLV
FT                   MADTLASAKARGVGCGAHPSFMDLWGFGRRPILGQSVGEIEKQLIYQIGALQALAHAQG
FT                   FKLAHVKTHGSLGNMANEDIELARAVARAIKAVDPGFIFIVMPGLPTERAGEEMGLKVA
FT                   REIYADRAYADNGNLASRKLPGAVLHDAEAAAERVLRIVESGEVVSISGARIPVRADTV
FT                   CVHGDTADAVAMARAVRTRLEGAGYGVRPMAEWL"
     atgaagacga tcgacctcaa ttgcgacatg ggcgagggct tcggcgtcta ttcgctcggc        60
     gacgataagg cgatgctcga tatcgtcact tccgccaaca tcgcctgcgg cttccatgcc       120
     ggcgacccgc tggtgatggc ggacacgctc gcgagcgcga aggcgcgcgg ggtgggttgc       180
     ggcgcgcatc cgagcttcat ggacctgtgg ggcttcggcc ggcggcccat cctcggccag       240
     agcgtcggag agatcgagaa gcaactcatc taccagatcg gcgcgctgca ggcgctcgcc       300
     catgcccagg gcttcaagct cgcccatgtg aagacgcatg gttcgctcgg caacatggcg       360
     aacgaggaca ttgagctggc gcgggcggtg gcgcgggcga tcaaggcggt ggaccccggc       420
     ttcatcttca tcgtcatgcc cggcctgccg accgaacggg cgggcgagga gatggggctg       480
     aaggttgcgc gcgagatcta tgccgaccgc gcctatgccg acaatggcaa cctcgcctcg       540
     cgcaagctgc ccggtgccgt gctgcacgac gcggaagccg cggcagagcg cgtgctgcgc       600
     atcgtcgaaa gcggcgaggt ggtctcgatc agcggcgcgc gcatccccgt gcgcgccgac       660
     acggtgtgcg tccacggcga caccgccgat gccgtggcca tggcgcgcgc cgtgaggacc       720
     cggctcgaag gcgccggcta tggcgtccgg ccgatggcgg agtggctata g                771
//

If you have problems or comments...

PBIL Back to PBIL home page