(data stored in ACNUC1104 zone)

EMBL: CP002026.PE185

CP002026.PE185       Location/Qualifiers
FT   CDS_pept        179360..180115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0186"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: bxe:Bxe_A4083 GntR family transcriptional
FT                   regulator; PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87522"
FT                   /db_xref="GOA:D7A112"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A112"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADH87522.1"
FT                   /translation="MSDADPAVPEKPGRAARYSEIEAALRAEINAGTHPVGAHLPTEHE
FT                   LCARFAASRFTIRQALAGLREEGLIDARAGVGTIVLASRRRETFVHRLSSIEELLQYPS
FT                   ETRRQHIRTDALAASPELAMLLKCRVGQPWVRLKALRLTQASLAPIAYFDIYVLPEHAG
FT                   VFDLPNPEGVSVLRQLEEMLNVRAAHAQVEIFVGHVTAELAEPLMARQDDPALVIIRRY
FT                   RGQDGAVFLVTYSVHPENRFTLNIEFERR"
     atgagcgatg ccgatccagc cgtgccggaa aagccgggac gtgccgcccg gtacagcgag        60
     atcgaggccg ccctgcgcgc cgagatcaat gcgggcaccc atccggtcgg cgctcacctg       120
     ccgacggagc acgagctgtg cgcccgcttc gcggcaagcc gcttcaccat tcggcaggcg       180
     ctcgcagggc tgcgggagga agggctgatc gatgcgcgcg ccggcgtcgg caccatcgtt       240
     ctcgccagcc gccggcgcga gaccttcgtg caccggctga gctcgatcga ggagctgctg       300
     caatatcctt cggagacccg ccgtcagcac ataaggacgg acgccctcgc cgcgtcgccc       360
     gaactggcca tgctgctgaa atgccgggtc gggcagccct gggtacggct gaaggccctc       420
     cgcctgacgc aggcatcgct cgcgcccatc gcctatttcg acatctatgt gctgccggaa       480
     catgcgggcg tgttcgacct tccgaacccg gaaggggtgt cggttctgcg tcagctcgag       540
     gaaatgctga acgtgcgtgc cgcacatgcc caggtcgaga tcttcgtcgg gcatgtcacg       600
     gcggaactgg ccgagccgct gatggcgcgc caggacgacc ccgccctcgt catcatccgt       660
     cgctaccggg ggcaggacgg cgccgtcttc ctcgtcacct attcggtgca tcccgagaac       720
     cgctttacgc tgaacatcga attcgagcgt cgctga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page