(data stored in ACNUC1104 zone)

EMBL: CP002026.PE187

CP002026.PE187       Location/Qualifiers
FT   CDS_pept        181505..182503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   dia:Dtpsy_2869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87524"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D7A114"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ADH87524.1"
FT                   /translation="MNAAVTFTRRAGLALLAGATLAAAVPAHAQSDYPNQPITVIVPFA
FT                   PGGASDFAARLLQPKLSEILGQQIVVENRDGAAGNVGMDLAARAKPDGYTLFLGNVGTV
FT                   SINPYIFSSLRVKPLQDFAPISIVADTPGLMIANPKFPPNNVKELVEYVKARPGQVNFA
FT                   SPGTGSVNRLEMEAFRREAGLDMIHVPYKGGAGPAAADVMGGHVSLMFVTISSGINHVK
FT                   GGRLKALGVTTKERVAQLPDVPTMTEQGFPKSVSSSWQGLLAPAGTPQPIIDKLHAAVV
FT                   EAMKDPTIRARMAESGVIAVSSPSPAEFKAYIKADADKWSGIIKEIGAKAD"
     atgaatgctg ccgtgacttt cacccgccgt gccggtctcg cgctcctggc cggagcaacg        60
     ctcgccgctg ctgtgccggc gcatgcgcaa tcggactatc cgaaccagcc gatcaccgtc       120
     atcgtgccct tcgcgcccgg cggcgcctcc gacttcgccg cccgcctgtt gcagccgaag       180
     ctctcggaga tcctcggcca gcagatcgtg gttgagaacc gcgacggcgc cgcaggcaat       240
     gtcggcatgg atctcgccgc ccgcgccaag ccggacggct acacgctgtt cctcggcaat       300
     gtcggcaccg tgtcgatcaa cccctacatc ttctccagcc tgcgggtgaa gccgctgcag       360
     gacttcgcgc cgatctccat cgtcgccgac acccccggcc tgatgatcgc gaacccgaag       420
     ttcccgccga acaacgtcaa ggaactggtg gaatatgtga aggcgcggcc ggggcaggtg       480
     aacttcgcct cgcccggcac cggctctgtg aaccggctgg agatggaggc gttccgccgc       540
     gaggcggggc tcgacatgat ccatgtgccc tataagggcg gtgccggtcc cgccgccgcc       600
     gacgtgatgg gcggccatgt cagcctgatg ttcgtgacca tttcctccgg catcaatcat       660
     gtgaagggcg ggcggctgaa ggcgctcggc gtcaccacca aggagcgcgt cgcgcagctg       720
     ccggacgtgc cgaccatgac cgagcagggc ttccccaaga gcgtctcctc ctcctggcag       780
     gggctgctcg ctcccgccgg cacgccgcag ccgatcatcg acaagctgca tgcggcggtg       840
     gtcgaggcga tgaaggaccc gaccatccgg gcgcgcatgg ccgaatccgg cgtcatcgcg       900
     gtgtcgagcc cgagcccggc ggagttcaag gcctatatca aggcggacgc cgacaaatgg       960
     agcggcatca tcaaggagat cggcgccaag gccgattga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page