(data stored in ACNUC1104 zone)

EMBL: CP002026.PE188

CP002026.PE188       Location/Qualifiers
FT   CDS_pept        182626..183072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0189"
FT                   /product="protein of unknown function DUF1468"
FT                   /note="PFAM: protein of unknown function DUF1468; KEGG:
FT                   mms:mma_0471 small permease component of tripartite
FT                   tricarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87525"
FT                   /db_xref="GOA:D7A115"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:D7A115"
FT                   /inference="protein motif:PFAM:PF07331"
FT                   /protein_id="ADH87525.1"
FT                   /translation="MDIRISSDFLTGLLFCGLGAVAIIIGSDYPIGTAARMGAGYFPLL
FT                   VSSGLILLGGVLIIRSFVTETEEVGSIDIRPLALLIGSILLFGLLIEDWGFPVAGLAVV
FT                   IGARIAGRQYKPLETILLAVGLVGFCLVLFSYGLGLHLPATHLW"
     atggatatca ggatctcttc cgacttcctc accgggctgc tgttctgcgg cctcggggcc        60
     gtcgccatca tcatcggctc cgactacccg atcggcaccg ccgcccgcat gggcgccggc       120
     tatttcccgc tgctggtgag ctccggtctc atcctgctgg gcggcgtgct gatcatccgc       180
     tccttcgtca ccgagaccga ggaagtcggc tcgatcgaca tacggccgct ggcgctgctg       240
     atcggcagca tcctgctgtt cggcctgctc atcgaggact ggggcttccc ggtggccggt       300
     cttgccgtgg tcatcggcgc gcgtatcgcc ggccggcaat acaagccgct ggagacgata       360
     ctgctcgcag tggggctggt cggcttctgc ctggtgctgt tctcctacgg tctcgggctg       420
     catctgcccg ccacccatct gtggtga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page