(data stored in ACNUC1104 zone)

EMBL: CP002026.PE191

CP002026.PE191       Location/Qualifiers
FT   CDS_pept        complement(185693..186238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0192"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bpy:Bphyt_5467 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87528"
FT                   /db_xref="GOA:D7A118"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D7A118"
FT                   /inference="protein motif:PFAM:PF02627"
FT                   /protein_id="ADH87528.1"
FT                   /translation="MDDLTAAPRYRELDPAHLDPAQRRIFEEIGRPRAGAVPAPFHIYV
FT                   ESPELAETAQALGAFCRYRTGLPPRLSELAILTTAAHWGAEYEFGVHAREARKAGVPEA
FT                   EIEALAAGRRPHFTDPDAALVHDFAGAVYREKDVPDELFAAAVERFGRRTVIELTGLLG
FT                   YYSMIAIALRVFRVPPPA"
     atggacgacc tcaccgccgc cccccgctat cgcgagctgg atcccgccca cctcgacccc        60
     gcgcagcgcc gcatcttcga ggagatcggc cgcccgcgcg ccggggcggt gccggcgccg       120
     ttccacatct atgtcgagag cccggaactc gcggagacgg cgcaggcgct cggcgccttc       180
     tgccgctacc gcaccggcct gccaccgcgc ctgtcggaac tcgccatcct caccaccgcg       240
     gcgcattggg gcgccgaata cgagttcggc gtccatgccc gcgaggcccg caaggccggc       300
     gtgccggagg ccgagatcga ggcgctcgcc gccggccggc gcccccactt caccgatccc       360
     gatgccgcgc tggtgcacga cttcgccggc gccgtctatc gcgagaagga cgtgccggac       420
     gaactcttcg ccgccgcggt cgagcgcttc ggccgccgga cggtgatcga gctgaccggc       480
     ctgctcggct actactccat gatcgcgatc gccctgcgcg tgtttcgcgt gccgccgccc       540
     gcgtga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page