(data stored in ACNUC1104 zone)

EMBL: CP002026.PE192

CP002026.PE192       Location/Qualifiers
FT   CDS_pept        complement(186248..187270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0193"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: jan:Jann_2956 oxidoreductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87529"
FT                   /db_xref="GOA:D7A119"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A119"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADH87529.1"
FT                   /translation="MIRAAIAGLGWWGKHMIRRMADSDELRIVAAIDTSDAQGAFAAEH
FT                   GIPLTTDWDDVLNDPSIDAVILCTPHSLHTAQVAMAARAGKHVFCEKPLALTRADAERS
FT                   VAACRAAGVKLGIGHERRYEPAMLEIKRLVQSGALGTIMHVEANFSHDKLAAVPKTDWR
FT                   ASTVDAPAAGMTAMGIHLTDGFIELFGPIDEVYASTATRATDRPNGDVVSVHTRFASGA
FT                   TGYLNAILVTPLYIGITVFGTDAWVEARNHTHPDTPGPTTLTLQHKDGRREVRDYEWTD
FT                   TVRANLEAFARSIESGTPYVFTDEQKVGNIAVLEAICRSVATNAPVKVEADRPALAASA
FT                   "
     atgatccgcg ccgcgatcgc cggcctcggc tggtggggca agcacatgat ccgccgcatg        60
     gcggattccg acgagctgcg catcgtcgcc gccatcgaca cctcggacgc tcaaggcgcc       120
     ttcgccgccg agcacggcat tccgctgacg accgactggg acgacgtgct gaacgatccc       180
     tcgatcgacg cggtcatcct ctgcaccccg cactcgctgc acaccgccca ggtcgcgatg       240
     gccgcccgcg ccggcaagca cgtcttctgc gagaagccgc tggcgctcac ccgcgcggac       300
     gccgagcgct cggtcgccgc ctgccgcgcc gccggggtga agctcggcat cggccatgag       360
     cgccgctacg agccggccat gctggagata aagcgcctgg tgcagtccgg cgcgctcggc       420
     acgatcatgc atgtcgaggc gaatttcagc cacgacaagc tcgccgccgt gccgaagacc       480
     gactggcgtg cctccacggt cgacgcgccc gccgccggca tgaccgccat gggcatccat       540
     ctgaccgacg gcttcatcga gctgttcggg cccattgacg aggtctatgc cagcaccgcc       600
     acccgcgcca ccgaccggcc gaacggcgac gtcgtgtccg tgcatacccg cttcgcctcc       660
     ggtgccaccg gctatctcaa cgccatcctg gtgacgccgc tctatatcgg catcaccgtg       720
     ttcggcaccg atgcctgggt cgaggcgcgc aaccatacgc atcccgatac gccgggcccg       780
     acgacgctga ccctccagca caaggacggc cggcgcgagg tgcgcgacta cgaatggacc       840
     gacacggtgc gcgccaatct cgaagccttt gcacgttcga tcgaatccgg cacgccctat       900
     gtgttcacgg acgagcagaa ggtcggcaac atcgcggtgc tggaagcgat ctgccgctcg       960
     gtggccacca acgcgccggt gaaggtcgag gcggaccgcc ccgccctcgc ggccagcgcc      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page