(data stored in ACNUC1104 zone)

EMBL: CP002026.PE196

CP002026.PE196       Location/Qualifiers
FT   CDS_pept        complement(189992..190450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0197"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   mms:mma_0820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87533"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7A123"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADH87533.1"
FT                   /translation="MSAPAATERGTINEGAFKAGDGAYLFQLDALSAIEGGPGYSTAIG
FT                   SVVEGIRTQCGLMRKARGTGARPHSHPNEQWNYVVQGRLRVNIEGEPERIAGPGTLIYF
FT                   PPNVTHYTIALPEEDVVFFVVKDTTHGIAGKAADGTMSGGHYDTPASS"
     atgtccgccc ccgccgccac cgaacgcggg accatcaacg agggcgcctt caaggccggc        60
     gacggcgcct atctgttcca gctcgacgcg ctctcggcca tcgagggtgg tcccggctac       120
     tccaccgcga taggcagcgt ggtggagggc atccgcaccc agtgcgggct gatgcgaaag       180
     gcgcgcggca ccggcgcccg cccgcattcg caccccaacg agcagtggaa ctatgtcgtg       240
     cagggccggc tccgggtgaa catagagggc gagccggagc gcatcgccgg gcccggcacg       300
     ctcatctatt tcccgccgaa cgtcacccac tacaccatcg ctctgcccga ggaggacgtg       360
     gtgttcttcg tggtgaagga caccacgcac ggcatcgccg gcaaggccgc ggacggcacg       420
     atgagcggcg ggcactacga cacgccggcc tcctcgtag                              459
//

If you have problems or comments...

PBIL Back to PBIL home page