(data stored in ACNUC1104 zone)

EMBL: CP002026.PE197

CP002026.PE197       Location/Qualifiers
FT   CDS_pept        complement(190469..191563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0198"
FT                   /product="Malate/L-lactate dehydrogenase"
FT                   /note="PFAM: Malate/L-lactate dehydrogenase; KEGG:
FT                   dsh:Dshi_2546 malate/L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87534"
FT                   /db_xref="GOA:D7A124"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:D7A124"
FT                   /inference="protein motif:PFAM:PF02615"
FT                   /protein_id="ADH87534.1"
FT                   /translation="MNAAVKPEPGAAASLPSAALEGLIADAMRACDLPPEDARGVARLM
FT                   VEADLTGADGHGIFRLPQYVRRLKGGGVNPTPRIEVERAAPGVALVDGDNGMGHLVMSV
FT                   AVEHAVALAREIGVAWVGVRRSNHAGPAALYVDMLARRGMVGIYSVVASSNHMAIWGGT
FT                   SSLLGTNPLAIAIPAGEDAPPVLLDIATTVVSYGTVKKHVLNDIPLPEGWLVSKQDGSA
FT                   ITDPKRSGEGLLLPIGGHKGSGLALMLGLLAGTLNGAAFGSEVVDFNADSSTETNTGHF
FT                   LLALDVARFMRPEAFAALLAQQLNGLRADAPLPGTEGVRIPGDRRAALRETRARDGVPI
FT                   APPLRRQLDELATSLAIPPLDDRL"
     atgaacgccg ccgtgaagcc ggagcccggc gccgccgcct ctctcccctc cgccgcgctc        60
     gaaggcctca tcgccgacgc gatgcgcgcc tgcgacctgc cgcccgagga tgccaggggc       120
     gtcgcgcgcc tcatggtcga ggccgatctc accggcgccg acggccacgg catctttcgc       180
     ctgccgcaat atgtgcggcg gctgaagggc ggcggcgtca accccacccc gcggatcgag       240
     gtggagcgcg ccgcccccgg cgtcgccctc gtcgacggcg acaacggcat gggccatctg       300
     gtgatgagcg tggcggtgga gcatgccgtc gccctcgccc gcgagatcgg cgtcgcctgg       360
     gtcggcgtgc gccgctccaa ccatgccggt cccgccgcgc tctatgtcga catgctggcg       420
     cggcgcggca tggtcggcat ctattcggtg gtggcaagct ccaaccacat ggcgatctgg       480
     ggcggcacct cctcgctgct cggcaccaac ccgctcgcca tcgccatccc ggcgggcgag       540
     gacgcgccgc cggtgctgct cgacatcgcc accacggtcg tctcctacgg caccgtcaag       600
     aagcatgtgc tgaacgacat cccgctcccc gagggctggc ttgtcagcaa gcaggatggc       660
     agcgccatca ccgacccgaa gcgcagcggc gagggcctgc tgctgcccat aggtggccat       720
     aagggctccg gcctcgccct catgctcggc ctgcttgccg gcacgctgaa cggcgccgcc       780
     ttcggcagcg aggtggtcga cttcaacgcc gattcctcga ccgagaccaa taccgggcat       840
     ttcctcctgg cgctggacgt cgcccgcttc atgcgcccgg aggccttcgc cgccctgctc       900
     gcgcaacagc tcaacggatt gcgtgccgac gcgccgctgc ccggcacgga gggcgtgcgc       960
     atccccggcg accgccgtgc cgccctgagg gaaacgcgcg cccgcgacgg cgtgccgatc      1020
     gcgccgccgc tacgccgcca gctcgacgag ctcgccacgt ccctcgccat cccgccgctc      1080
     gacgaccgcc tctga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page