(data stored in ACNUC1104 zone)

EMBL: CP002026.PE198

CP002026.PE198       Location/Qualifiers
FT   CDS_pept        complement(191560..191970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0199"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   rhi:NGR_c25840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87535"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7A125"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADH87535.1"
FT                   /translation="MSNAAILRPDQLPVTERGGGARTVRLVTAELGSQKLLNGITRFGP
FT                   GASIPLHSHNCEESVIILEGDAVFEIDGVTHELKTHDTTWIPPDVPHRFRNASDSAPLA
FT                   IFWTYADVAATRTMAATGETRSIASEHAGNGR"
     atgagcaacg cggccatcct ccgcccggac cagctgcccg tcaccgagcg cggcggcggc        60
     gcacgcaccg tgcgcctcgt caccgccgag ctcggctcgc agaagctgct caacggcatc       120
     acccgcttcg gccccggcgc gagcatcccg ctgcacagcc acaattgcga ggagagcgtc       180
     atcatcctcg aaggcgacgc ggtgttcgag atcgacggcg tcacccacga gctgaagacg       240
     cacgacacca cgtggatccc gccggacgtg ccgcaccgct tccgcaacgc ctcggacagc       300
     gcgccgctcg ccatcttctg gacctatgcc gacgtcgccg ccacccgcac catggccgcg       360
     accggcgaga cccgttccat cgcttccgag catgcgggga acggccgatg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page