(data stored in ACNUC1104 zone)

EMBL: CP002026.PE199

CP002026.PE199       Location/Qualifiers
FT   CDS_pept        complement(191967..192992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0200"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: swi:Swit_1683
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87536"
FT                   /db_xref="GOA:D7A126"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7A126"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ADH87536.1"
FT                   /translation="MNAPVIDVHAHILTEEMMARMRREAPEIGPTLSEVDAEGGVLKVG
FT                   DIVQRPFPRGGWDLDRRFADLDHAGFDLQVLSNCPQTFLYEREAALTAALCQIQNEAIA
FT                   DLVRRHPSRFLGIATLPMQDPARAANELRRAVTRLGLKGAQIGSHIEGRNLDDPALEPL
FT                   WATAEELGAFILIHPQKTAAGERTKEFYLKNLIGNPLETTIAAASLVFGGVLERYPDLR
FT                   ICLVHGGGFLPFQTGRMIHGWKERPECRRLIKESPEVSIRRLYFDTLTHFGPALRYLTD
FT                   TFGAGHVLLGSDYPFDMGTLEGARQVRAAGLAPAEEAAILGGTAAGWFGLSAAERKAVR
FT                   A"
     atgaatgctc ccgtgatcga cgtccacgcc catatcctca ccgaggagat gatggcccgc        60
     atgcgccgcg aggcgcccga gatcggcccg accttgtccg aggtcgacgc cgagggcggc       120
     gtgctgaagg tcggcgacat cgtgcagcgg cccttcccgc gtggcggctg ggacctcgac       180
     aggcgcttcg ccgacctcga ccatgccggc ttcgacctgc aggtgctgtc caactgcccg       240
     cagaccttcc tctatgaacg cgaggctgcg ctcaccgccg cgctgtgcca gatccagaac       300
     gaggccatcg ccgaccttgt gcgccgccat ccctcgcgct tcctcggcat cgcgacgctg       360
     cccatgcagg acccggcgcg ggcggcgaac gaactgcgcc gcgccgtgac caggctcggc       420
     ctcaagggcg cgcagatcgg ctcgcatatc gagggccgca acctcgacga tccggcgctg       480
     gagccgctct gggccaccgc cgaggagctc ggcgccttca tcctcatcca cccgcagaag       540
     acggcggcgg gggagcggac gaaggagttc tatctgaaga acctcatcgg caatccgctg       600
     gagaccacca tcgcggcggc ctcgctcgtc ttcggcggcg tgctggagcg ctatcccgat       660
     ctcaggatct gcctcgtgca tggcggcggc ttcctgccct tccagaccgg ccggatgatc       720
     catggctgga aggagcggcc ggaatgccgg cgcctcatca aggagagccc ggaggtttcg       780
     atccgccgcc tctacttcga cacgctgacc catttcggac cggcgctgcg ctatctcacc       840
     gacaccttcg gcgccggcca tgtgctgctc ggcagcgact atcccttcga catgggcacg       900
     ctggagggcg cccgtcaggt gcgcgccgcc ggcctcgccc cggctgagga ggcggcgatc       960
     ctcggcggca cggcggccgg ctggttcggc ctgtccgcgg cagagcggaa ggcggtgcgc      1020
     gcatga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page