(data stored in ACNUC1104 zone)

EMBL: CP002026.PE20

CP002026.PE20        Location/Qualifiers
FT   CDS_pept        14442..14912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0020"
FT                   /product="phage protein, HK97 gp10 family"
FT                   /note="KEGG: avi:Avi_1977 hypothetical protein; TIGRFAM:
FT                   phage protein, HK97 gp10 family; PFAM: TP901-1 ORF40 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87357"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZU3"
FT                   /inference="protein motif:TFAM:TIGR01725"
FT                   /protein_id="ADH87357.1"
FT                   /translation="MARSSIVGLAKLHRKIAKLPEQARTDIRAAMEKVAEQIVDLARSL
FT                   VPTVSGDLRDSIGWTWGRPPRGSISLGTVARAKLGASMTITIYAGNDEAFYARWVEFGT
FT                   AAHVNGGLFAGTRNPGTQARPFFYPAFRAHRRIARREVRKAIRSAARKVAKQ"
     atggcaaggt ctagcatcgt cggcctcgcc aagctgcacc ggaagatcgc aaagctgccg        60
     gaacaggcgc gcacggatat ccgcgcggca atggagaagg tggcggagca aatcgtggac       120
     ttggcccggt cactcgtgcc gaccgtcagc ggcgatctcc gcgacagcat cgggtggacg       180
     tggggacgtc cgccgcgcgg gtcgatctcg ctgggcacgg tggcccgggc aaagctcggc       240
     gccagcatga cgatcacgat ctatgccggc aatgacgagg ccttctatgc ccgctgggtc       300
     gagttcggca cggcggctca cgtcaatgga gggttgttcg ccggcacccg caacccgggc       360
     acgcaggccc ggccgttctt ctaccccgcc tttcgggctc accggcgcat agcgcgccgc       420
     gaggtgcgca aggccatccg ttcggcggcc cgcaaggtgg cgaagcaatg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page