(data stored in ACNUC1104 zone)

EMBL: CP002026.PE201

CP002026.PE201       Location/Qualifiers
FT   CDS_pept        complement(194547..194999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0202"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddr:Deide_3p01370 hypothetical protein;
FT                   putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87538"
FT                   /db_xref="GOA:D7A128"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:D7A128"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87538.1"
FT                   /translation="MRVTNFIVALALFALSAGVLLGTWDLPYWADFAPGSAFAPFWVAT
FT                   IGIILAIALFVATLAEDGSEPHQFPDRRGIARVTALVAGLWLMVLLIPLIGFLSASALL
FT                   CLLLLLGIERRPVVPSLFATAVVISLVYGVFIAWLGIALPAGPFGI"
     atgcgtgtca ccaatttcat cgtagccctg gcgctgttcg ccctctcggc cggcgtgctg        60
     ctcggcacct gggacctgcc ctactgggcc gatttcgcgc cgggctccgc cttcgcaccc       120
     ttctgggtgg caacgatcgg catcatcctc gccatcgccc ttttcgtcgc cactctggcg       180
     gaggacggca gcgagccgca ccaattcccc gaccggcggg ggatcgcccg cgtcaccgcc       240
     ctcgtcgctg gcctgtggct gatggtgcta ctcatcccgc tcatcggctt cctctccgcc       300
     agcgccctgc tctgcctcct cctgcttctc ggcattgagc ggcgtcccgt cgtcccgagc       360
     ctgttcgcca cggcggtggt gatctccctg gtctatggcg tgttcatcgc gtggctcggc       420
     atcgcgctgc ccgccggtcc cttcggcatc tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page