(data stored in ACNUC1104 zone)

EMBL: CP002026.PE205

CP002026.PE205       Location/Qualifiers
FT   CDS_pept        complement(196629..197636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0206"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: rce:RC1_0589 cobalamin
FT                   synthesis protein CobW, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87542"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:D7A132"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ADH87542.1"
FT                   /translation="MAIPVVLITGFLGSGKTTLLNHLLWDPEMGDTAVIINEFGDVAID
FT                   HLLVESAIENAVVLQSGCICCTVRGDLVDTLDDLCAKVARGELPPFSRIAIETTGLADP
FT                   ASLVRTFLTERLLADRFTLRAVVTTVDAVNGAVQLDEFEEARHQAALADVIVLTKSDLA
FT                   SPEAVASLTARLKEANPSAAIVPVVHGAIAPDTLFALVPAHPSRADDEVLAWLNSEAFE
FT                   ETDGHAHSHHDSSIKPFAVTLDRPVTREALRSWLRSILSLRGADLLRMKGIVALKGEAA
FT                   PIVVHAVQNALYPPVQLAAWPSDDHTTRIVFITRDIAPEALRNSLEVLASRSAA"
     atggccatcc ccgtcgtact gatcaccggc ttcctcggca gcggcaagac cacgctgctg        60
     aaccatctgc tgtgggaccc ggagatgggc gacaccgcgg tcatcatcaa cgagttcggc       120
     gatgtcgcca tcgaccatct gctggtcgag agcgccattg agaacgccgt ggtgctgcag       180
     agcggctgca tctgctgcac cgtgcgcggc gatctcgtcg acacgctcga cgatctctgc       240
     gccaaggtcg cgcgcggtga actgccgccc ttctcgcgca tcgccatcga gaccaccggc       300
     cttgcggatc ccgcctcgct ggtgcgtacc ttcctgaccg agcgcctgct ggccgatcgc       360
     ttcacgctgc gcgcggtagt gaccacggtc gacgcggtga acggcgccgt gcagctcgac       420
     gaattcgagg aagcccgcca tcaggccgcc ctcgccgacg tcatcgtgtt gaccaagtcc       480
     gacctcgcct cgcccgaggc cgtcgcctct ctcacggcgc ggctcaaaga ggcgaatcct       540
     tcagccgcca tcgtgccggt ggttcatggc gccattgccc cggacacgct tttcgccctg       600
     gtgcccgcgc atccctcgcg tgcggacgac gaggtgctgg cctggctcaa cagcgaagcg       660
     ttcgaggaga ccgacggtca cgcacattcc catcacgaca gcagcataaa gcccttcgcc       720
     gtcacgctgg accggccggt gacacgcgag gcgctgcgca gctggctgcg gtcgatcctg       780
     tccctgcgcg gcgccgacct gctgcggatg aagggcatcg tggcgctgaa gggcgaggcc       840
     gcgcccatcg tcgttcatgc ggtgcagaac gcgctctatc cgccggtcca gctcgcggca       900
     tggccgagcg acgaccacac cacgcgcatc gtcttcatca cccgcgacat cgctccggag       960
     gccttacgca acagtcttga agttctcgcg tcgcgcagcg cggcctga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page