(data stored in ACNUC1104 zone)

EMBL: CP002026.PE208

CP002026.PE208       Location/Qualifiers
FT   CDS_pept        complement(199880..200572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0209"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: jan:Jann_2950
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87545"
FT                   /db_xref="GOA:D7A135"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7A135"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADH87545.1"
FT                   /translation="MAGRSSTSLAAGAKPPAPRRTRNKPEERHREFVRKAVELFAEVGF
FT                   EAGTRELAQRLGVTQPLLYRYFPSKDDLIAAVYQEIYVNRWKPEWREGLIDESRPIRDR
FT                   LIAFYEDYTETIFTPEWLRIYLFAGLRGVDINRRYAATVEAEILRPITVATRKSFGLGD
FT                   DDPPTPEEVELSWTLQGGIFYYGVREIVYRFPRTVDRATMIRNAVDTFLAGVGSVMKRL
FT                   AERESDPA"
     atggccggac gttcatccac atcgctcgcg gcgggcgcca agccccccgc gccgcggcgc        60
     acgcgcaaca agccggagga acggcacagg gagttcgtcc gcaaggccgt cgagctgttc       120
     gccgaggtcg gcttcgaagc gggcacgcgc gaactcgccc agcggctcgg cgtcacccag       180
     ccgctgctct accgctattt cccgagcaag gacgacctga tcgccgccgt ctaccaggag       240
     atctacgtca atcgctggaa gccggaatgg cgcgagggcc tgatcgacga gagccgcccg       300
     atccgggacc ggctcatcgc cttctatgag gactacaccg agacgatctt cacgccggaa       360
     tggctgcgca tctatctctt cgcgggcctg cgcggcgtcg acatcaatcg gcgctatgcc       420
     gccaccgtcg aggccgagat cctgcgtccg atcaccgtcg cgacccgcaa gagcttcggt       480
     ctgggcgacg acgaccctcc gacgcccgag gaggtcgagc tgtcctggac cctgcagggc       540
     ggcatcttct actatggcgt gcgcgagatc gtgtaccgct tcccccggac ggtggaccgc       600
     gcgaccatga tccgcaacgc ggtcgatacg ttcctcgccg gcgtcggctc ggtgatgaaa       660
     cggctcgccg agcgcgaaag cgatcccgct taa                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page