(data stored in ACNUC1104 zone)

EMBL: CP002026.PE209

CP002026.PE209       Location/Qualifiers
FT   CDS_pept        complement(200607..201827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0210"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain protein"
FT                   /note="PFAM: Acyl-CoA dehydrogenase type 2 domain; KEGG:
FT                   bja:bll6096 putative pigment protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87546"
FT                   /db_xref="GOA:D7A136"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D7A136"
FT                   /inference="protein motif:PFAM:PF08028"
FT                   /protein_id="ADH87546.1"
FT                   /translation="MSHTIPLAAPRTIRSAAEQRHDELLQRATDLATAFAERAPRAEEL
FT                   SRLPPENERDLHESGLYRMLQPEAVGGSEVGYESLITIGAALAAGCASTAWNLTNLASH
FT                   HWMLAMFAPAAQDRIWREDPDALIASSFVFPAAKVTKAPGGYVLSGRWPFSSGVDVCSW
FT                   NMLAGIVRAEGEAPDHRVFLVPRSDYRILDTWHVTGLKGTGSNDVQCEEVFVPEEMSVS
FT                   VEHLKGGLTPGSERHPAPLYRLPVFALFPAILSGVGLGNGEGALTAYVAATRKRSANYT
FT                   GARLAELQSIQIHIGNAATRLAHARRVMLAICEEAMRDAERGHVPDMVTKFAYRRDLAY
FT                   ATKLTTKAVDEINAGSGAQALYLSGSQQRRFRDAHAISAHIAFSTDVANAAFGRLALGL
FT                   EVDNPVV"
     atgtcccaca ccatccccct cgccgccccg cgcacgatcc gctcggctgc cgagcaacgc        60
     cacgacgaat tgctccagcg cgccaccgac ctcgccacgg ccttcgccga gcgcgcgccc       120
     cgtgccgagg aactgagccg cctgccgccg gagaacgagc gcgacctgca tgagagcggc       180
     ctctaccgca tgctccagcc cgaggcggtc ggcggttccg aagtcggcta cgaaagcctg       240
     atcaccatcg gcgcggcgct cgccgccggc tgtgcctcca cggcttggaa cctcaccaac       300
     ctcgccagcc accactggat gctggccatg ttcgcgccgg ccgcacagga ccgcatctgg       360
     cgggaggatc ccgacgcgct gatcgcctcc tccttcgtct tcccggcggc gaaggtgacg       420
     aaggcacccg gcggctacgt cctctccggc cgctggccgt tctcttccgg cgtcgacgtc       480
     tgctcctgga acatgctggc cggcatcgtc cgcgcggagg gagaggcgcc ggaccaccgc       540
     gttttcctcg tcccgcgctc ggactaccgc atcctcgaca cctggcacgt caccgggctg       600
     aagggcacgg gctccaacga cgtccagtgc gaagaggtgt tcgtgccgga agagatgagc       660
     gtctcggtcg aacatctgaa gggcggcctc acgcccggca gcgagcgcca tcccgccccg       720
     ctctaccggc taccggtgtt cgcgctgttc ccggcgatcc tctccggagt cggcctcggc       780
     aatggcgagg gcgcgctcac cgcctatgtg gccgccaccc gcaagcgctc ggccaattac       840
     accggcgcgc ggctggccga gctgcagagc atccagatcc atatcggcaa tgccgccacc       900
     cggctcgccc atgcgcggcg cgtaatgctc gccatctgcg aggaggcgat gcgcgacgcc       960
     gagcgcggcc acgtcccgga catggtgacg aagttcgcct atcggcgcga cctcgcctat      1020
     gcgacgaaac tcacgacgaa ggcggtcgac gagattaatg ccggcagcgg tgcgcaagcg      1080
     ctctacctca gcggcagcca gcagcgacgc tttcgcgatg cgcatgctat aagcgcgcat      1140
     atcgccttca gcaccgatgt cgccaacgcc gccttcggcc gcctggcgct cgggctggag      1200
     gtggacaatc ccgtggtgtg a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page