(data stored in ACNUC1104 zone)

EMBL: CP002026.PE21

CP002026.PE21        Location/Qualifiers
FT   CDS_pept        14909..15331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: avi:Avi_1978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87358"
FT                   /db_xref="InterPro:IPR021508"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZU4"
FT                   /inference="similar to AA sequence:KEGG:Avi_1978"
FT                   /protein_id="ADH87358.1"
FT                   /translation="MIDPVLELQGVITARLKANDDLRALIDRRVYDSVPRDRDGGVTAK
FT                   FPYVSFGPTTELQDDADCIAATEFTLQIDAWSREPGFPEVRRIAKAVKAALHEQEITLA
FT                   ENALATFEWWRADVIRAPDGITSHAAITFRGVIEQS"
     atgattgacc cggtgctgga gcttcagggg gtgatcaccg cccgcctgaa ggccaatgac        60
     gatctgcgcg ctctgatcga ccgccgcgtc tatgacagcg tgccccgtga ccgcgatggc       120
     ggcgttacgg ccaagttccc ctacgtgtcc ttcggcccga cgaccgaatt gcaggacgac       180
     gccgactgca tcgccgcgac cgagttcacg ctgcagatcg acgcctggtc gcgcgagccc       240
     ggttttcccg aggtccgacg gatcgccaag gccgtcaagg cggcgctgca cgaacaagag       300
     atcaccctcg cggagaatgc gctcgccacc ttcgaatggt ggcgggccga cgtgatccgc       360
     gcgcccgacg gcattaccag ccatgccgcg atcacctttc gcggcgtgat cgagcagtcc       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page