(data stored in ACNUC1104 zone)

EMBL: CP002026.PE210

CP002026.PE210       Location/Qualifiers
FT   CDS_pept        complement(201840..202319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0211"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87547"
FT                   /db_xref="GOA:D7A137"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D7A137"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADH87547.1"
FT                   /translation="MRATGLNHLSIGAKDVDASVRFYVEMFGMEVIPTYNFGFRTQYLR
FT                   CGDQQLHIFGLPDATPHYQHFAINVDDFMGVYERARDAGLIDHATFGNGVNEMPDGTVQ
FT                   LYLRDPGGNLVEVDWPDVSSLDTGRIPELKRLADRFEQVGENLEATLFLDRRRRA"
     atgcgagcca ccggcctgaa ccacctctcc atcggcgcga aggacgtcga tgcgtccgtg        60
     cgcttctatg tcgagatgtt cggcatggag gtcatcccga cctataattt cggcttccgc       120
     acccagtatc tgcgctgcgg cgaccagcag ttgcacatct tcggcctgcc cgacgccacg       180
     ccgcactacc agcacttcgc gatcaacgtc gacgacttca tgggcgtgta tgagcgcgcc       240
     cgcgacgccg gcctcatcga tcacgcgacc ttcggcaacg gcgtcaacga gatgccggac       300
     ggcaccgtgc agctctatct gcgcgatccc ggcggcaacc tcgtcgaggt cgactggccg       360
     gacgtctcca gcctcgacac cggccgcatt cccgagctga agcgcctcgc cgatcgcttc       420
     gagcaggtcg gagagaacct cgaggcgacg ctgttcctcg accgccgccg gcgcgcgtga       480
//

If you have problems or comments...

PBIL Back to PBIL home page