(data stored in ACNUC1104 zone)

EMBL: CP002026.PE212

CP002026.PE212       Location/Qualifiers
FT   CDS_pept        204067..204711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0213"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: met:M446_0530 GntR family transcriptional
FT                   regulator; PFAM: GntR domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87549"
FT                   /db_xref="GOA:D7A139"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A139"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADH87549.1"
FT                   /translation="MKLVRNRVYEMVRREILSCAIVPGAELREADLAERFGVSKSPIRD
FT                   AMQKLELEGLVEIEPRRGHRVMPVSISDAADMLELRLILETAGVRKVALVATDAELAGL
FT                   DNFRDADTSSIPVFTEYNRRFHHHLAALARNRRLAEEMSRVMDLYERLCMVSLSAVTAH
FT                   GRNEGPLREHNDIIDALQARNGNAAARMLKRHIGRSQSQILRALESRPIVA"
     atgaagctgg ttcgcaacag ggtgtatgag atggtgcggc gggagatcct gtcctgcgcc        60
     atcgtgcccg gcgcggagct gcgggaggcc gacctcgccg agcgcttcgg cgtcagcaag       120
     tcgccgatcc gtgacgccat gcagaagctc gaactcgaag gcctcgtcga gatcgagccg       180
     cggcgcggcc accgcgtgat gcccgtctcc atcagcgacg ccgccgacat gctggagctc       240
     aggctgatcc tcgagacggc gggcgtgcgc aaggtggcgc tcgtcgccac cgacgccgag       300
     ctcgccgggc tcgacaattt ccgcgatgcc gacaccagct cgatcccggt cttcaccgaa       360
     tataaccgcc ggttccacca tcacctcgcc gcgctcgcgc gtaaccgccg cctcgcggag       420
     gagatgagcc gggtgatgga cctctatgag cggctctgca tggtgagcct ttccgccgtg       480
     accgcgcatg gccggaacga ggggccgctg cgcgagcaca acgacatcat cgacgccctg       540
     caggcgcgca acggcaatgc cgccgcgcgc atgctgaagc gccacatagg gcgctcgcag       600
     agccagatcc tgcgagccct cgaaagccgt ccgatcgtcg cctga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page