(data stored in ACNUC1104 zone)

EMBL: CP002026.PE213

CP002026.PE213       Location/Qualifiers
FT   CDS_pept        204887..205687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0214"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ABC transporter related protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87550"
FT                   /db_xref="GOA:D7A140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A140"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87550.1"
FT                   /translation="MNAIASQLVAASTSHIDPDIVISARDLVKAFNSEVVALDRASFDI
FT                   KRGSFVSLVGPSGCGKSTLLRLVAGLIGKSAGELSVLGHGVTGPSHDVGMMFQRPTLLE
FT                   WRTAVENVLLPTEVQGATTDADRRRAIELLQLVGLRDFEFSFPRQLSGGMQQRVALARL
FT                   LQTGANILLLDEPFGALDEFTRERLNLELLRIVDDVEATVLFVTHNISEAIFLADQVMV
FT                   MTPRPGRLAKIVDVSFERPREIALMQTPEFNRLVGEVRSILGGH"
     atgaacgcca tagccagcca gctggtcgcc gcctcgacca gccatatcga ccccgacatc        60
     gtcatttccg cccgcgacct cgtcaaagcc ttcaacagcg aggtggtggc gctcgaccgc       120
     gccagcttcg acatcaagcg cggctccttc gtctcgctgg tcgggccgag cggctgcggc       180
     aagtccacgc tgctgcgcct cgtcgccggg ctgatcggca agtcggcggg cgaattgagc       240
     gtgctcggcc acggcgtcac cgggccgtcc cacgatgtcg gcatgatgtt ccagcgcccg       300
     acgctgctgg aatggcgcac ggcggtggag aacgtgctgc tgccgaccga ggtgcagggc       360
     gcgaccaccg acgccgaccg ccgccgggcg atcgagctgc tgcaactcgt ggggttgagg       420
     gatttcgagt tcagcttccc gcgccagctt tcgggcggta tgcagcagcg cgtggcactg       480
     gcccgcctgc ttcagaccgg cgccaacatc ctgctgctcg acgagccgtt cggcgcgctc       540
     gacgaattca cccgcgagcg gctgaacctc gaattgctgc gcatcgtcga cgatgtcgag       600
     gcgaccgtgc tgttcgtcac ccacaacatc tccgaggcga tcttcctcgc cgaccaggtg       660
     atggtgatga cgccgcgccc cggccgcctc gcgaagatcg tcgacgtttc cttcgagcgc       720
     ccgcgcgaga tcgcgctgat gcagacgccg gagttcaacc ggctggtcgg cgaggtccgc       780
     tccatcctgg gagggcattg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page