(data stored in ACNUC1104 zone)

EMBL: CP002026.PE214

CP002026.PE214       Location/Qualifiers
FT   CDS_pept        205689..206564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0215"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mno:Mnod_2985
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87551"
FT                   /db_xref="GOA:D7A141"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A141"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87551.1"
FT                   /translation="MSLATDGNLSMTDVARERGGLAGRVMRHVALFLGVMLVWELASYY
FT                   QFVDPLILPRPTAIAAALVNMVLYQGTVWFHLGVTLWEAVAGFVIGSAIGIGLAVAAGL
FT                   NESFRRYISPYIIALQVTPRIALAPIVIAWLGFGMMPKIAIGALICFFPPFINTLTGLL
FT                   NVDEDANEMFRSLGARKRQIFFSLMLPNAMPIIMAGLKTAISLALIGAIVGEFISASEG
FT                   MGVLMQRYTFALNMASSFAVLVILTAMGYVLFLLMEWADNWLVYWRHDARMTAISRKKA
FT                   RAWGGVTGRR"
     atgagcctcg ccaccgacgg caacctgtcc atgaccgacg tcgcgcgcga gcgcggcggt        60
     cttgccgggc gcgtcatgcg ccatgtcgcg ctgttcctcg gcgtgatgct ggtatgggag       120
     ctcgccagct actaccagtt cgtcgatccg ctcatcctgc cgcggccgac cgccatcgcc       180
     gcggcgctgg tgaacatggt gctctatcag ggcacggtgt ggttccatct cggcgtcacg       240
     ctgtgggagg cggtggcggg cttcgtcatc ggctcggcga tcggcatcgg cctcgccgtg       300
     gcggcggggc tgaacgagag cttccgccgc tacatctcgc cctacatcat tgcgctgcag       360
     gtgacgccgc gcatcgcgct ggcgccgatc gtcatcgcct ggctcggctt cggcatgatg       420
     ccgaagatcg ccatcggcgc gctgatctgc ttcttcccgc ccttcatcaa cacgctgacg       480
     ggactgctca acgtcgacga ggacgccaac gagatgttcc gctcgctggg cgccaggaag       540
     cggcagatct tcttcagcct gatgctgccc aacgccatgc cgatcattat ggcggggctg       600
     aagacggcga tatcgctcgc gctgatcggc gccatcgtcg gcgagttcat ctcggcgagc       660
     gagggcatgg gcgtgcttat gcagcgctac accttcgcgc tgaacatggc ctcgtccttc       720
     gcggtgctcg tgatcctcac cgccatgggc tacgtgctct tcctgttgat ggagtgggcc       780
     gacaactggc tggtctactg gcgccacgac gcgcgcatga ctgccatcag ccgcaagaag       840
     gcgagagcct ggggcggcgt caccggccgg cgctag                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page