(data stored in ACNUC1104 zone)

EMBL: CP002026.PE217

CP002026.PE217       Location/Qualifiers
FT   CDS_pept        208906..209820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0218"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   jan:Jann_2944 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87554"
FT                   /db_xref="GOA:D7A144"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D7A144"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADH87554.1"
FT                   /translation="MGLLSERAPYLAFPDRPRLHLPGEARVAVWVIVNVEEWSIARAMP
FT                   RTVLPPPMGQPLMPDLPNWAWHEYGMRVGFWRLLKAIEQRGLRATFAVNGHVCRSYERV
FT                   ARAARDAGWEFMGHGYVQQPMHNTEDQRAAIFDTVAAIRDFTGRPPPGWESPGLTENNE
FT                   TLDLLKEAGIGYVANWVIDDLPLELDTPHGPILSVPYSVETNDIVVHAVQHQPSDAFNR
FT                   RCVDQFDRLWEEGGDNAKVMAISTHPYLTGVPHRIGYFEQLLDYVCSRDQVALMTGEEI
FT                   AGWYRGEQARLGSERREARAARG"
     atggggctgc tcagcgaacg cgcgccttat ctcgccttcc cggacaggcc gcgcctgcat        60
     ctgccgggcg aggcccgcgt cgcggtgtgg gtcatcgtca atgtcgagga atggtccatc       120
     gcgcgggcca tgccgcgcac cgttctgcca ccgcccatgg gccagccgct gatgccggac       180
     ctgcccaatt gggcctggca cgaatacggc atgcgggtcg gcttctggcg actgctcaag       240
     gcgatcgagc agcgcggcct gcgcgccacc ttcgcggtga acgggcatgt gtgccgttcc       300
     tatgagcgcg tcgcacgggc ggcgcgcgat gccggctggg agttcatggg gcatggctat       360
     gtgcagcagc cgatgcataa taccgaggac cagcgggcgg cgatcttcga cacggtggcg       420
     gccatacgcg acttcaccgg tcggccgccg ccgggctggg agagccccgg cctcaccgag       480
     aataacgaga cgctcgacct gctgaaggag gcgggcatcg gctatgtcgc caactgggtg       540
     atcgacgatc tcccgctgga gttggacacg ccgcatggcc cgatcctgtc ggtgccctat       600
     tcggtggaga ccaacgacat cgtggtgcat gccgtgcagc atcagccgtc cgacgccttc       660
     aaccggcgct gcgtcgacca gttcgaccgg ctgtgggagg agggcggcga caacgccaag       720
     gtgatggcaa tcagcacgca tccctacctg accggcgtgc cgcatcgcat cggctatttc       780
     gagcagctgc tcgactatgt ctgctcgcgc gaccaggtgg cgctgatgac cggcgaggag       840
     atcgccggat ggtatcgcgg cgagcaggcc cggctcggct cagaacggcg ggaggcgagg       900
     gccgcccggg gctga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page