(data stored in ACNUC1104 zone)

EMBL: CP002026.PE219

CP002026.PE219       Location/Qualifiers
FT   CDS_pept        complement(210453..211307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0220"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aha:AHA_2938 taurine
FT                   transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87556"
FT                   /db_xref="GOA:D7A146"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A146"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87556.1"
FT                   /translation="MMNMAGAQPLARAPTSPTQKAPVPPAPRTLSPRMVDIGVQVAVVA
FT                   ALAGLWEFGARFGALNPFLLPPLSVVLGRIWEDLIAGTVLVDLGLTLYRALAGFAIGAV
FT                   IGIPLGILMARSALVRWFFDPLVSIGFPMPKIAFLPIFILWFDIYDTSKIIMVAFSCFF
FT                   PIVAATYAGCSSLDKWPIWSARSFGAKERDLLWEVYLPMAMPQIITGLQVALPVGMITT
FT                   IVTEMLMGGRGVGGAMIMAGRFADSVGVFAGIVQIIILGFVVVKSLEIVRRRILVWHPE
FT                   SRR"
     atgatgaaca tggctggagc ccagccgctc gcgcgcgccc ccacatcacc gacgcagaag        60
     gcgccggtgc cgcccgcgcc ccgtaccctg tcgccgcgca tggtcgacat cggcgtgcag       120
     gtggcggtag tagcggcgct cgccggcctg tgggaattcg gcgcgcgctt cggtgccctc       180
     aaccccttcc tgctgccgcc gctcagcgtg gtgctggggc ggatctggga ggacctcatc       240
     gccggcacgg tgctggtcga tctcggcctc accctctacc gcgcgctcgc cggcttcgcc       300
     atcggcgccg tgatcggcat cccgctcggc atactgatgg cgcgctcggc actggtgcgc       360
     tggttcttcg atccgctggt gtcgatcggc ttcccgatgc cgaagatcgc cttcctgccg       420
     atcttcatcc tgtggttcga catatacgac acctcgaaga tcatcatggt ggcgttctcc       480
     tgcttcttcc ccatcgtggc ggcgacctat gccggctgtt cgagcctcga caaatggccg       540
     atctggtcgg cccgctcctt cggggcgaag gagcgtgatc tcctgtggga ggtctatctg       600
     ccgatggcga tgccgcagat catcaccggc ctgcaggtgg cgctgccggt gggcatgatc       660
     accaccatcg tcaccgagat gctgatggga gggcgcggcg tcggcggcgc gatgatcatg       720
     gccgggcgct tcgccgattc cgtcggcgtg ttcgccggca tcgtgcagat catcatcctc       780
     ggcttcgtgg tggtgaaaag cctcgagatc gtccgccgcc gcatcctggt ctggcatccc       840
     gagagccggc ggtga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page