(data stored in ACNUC1104 zone)

EMBL: CP002026.PE22

CP002026.PE22        Location/Qualifiers
FT   CDS_pept        15389..15835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: avi:Avi_1979 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87359"
FT                   /db_xref="InterPro:IPR011855"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZU5"
FT                   /inference="similar to AA sequence:KEGG:Avi_1979"
FT                   /protein_id="ADH87359.1"
FT                   /translation="MAKPTTMKGGQVRVLIGNDEDPIVYAAPCGFTERSVTLSKNLEEV
FT                   VIPDCDDPDAVDWVGRDASSLSMAISGEGVMAEQSVETWLDAWENPNSVPVKVEWGFPN
FT                   KTITWTGLMHVESIEATGANGQRVRKSISMQSDGEMARVVTPNA"
     atggccaaac cgaccaccat gaagggcggg caggtccgcg tccttatcgg caatgacgaa        60
     gatcccatcg tctacgccgc gccctgcggc ttcaccgagc ggtcggtgac gctgtcgaag       120
     aacctcgagg aggtggtgat ccccgactgc gacgatcccg acgcggtgga ctgggtcggc       180
     cgcgacgcct cgtcgctcag catggcgatc tccggcgagg gcgtcatggc cgagcagtcg       240
     gtcgagactt ggctcgatgc ctgggagaat ccgaactcgg ttccggtgaa ggtcgaatgg       300
     gggttcccca acaagaccat cacctggacc gggctgatgc atgtcgagag catcgaggcc       360
     accggcgcca acggccagcg ggtgcgcaag agcatcagca tgcagtcgga tggcgagatg       420
     gcccgcgtgg tcacgcccaa tgcgtga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page