(data stored in ACNUC1104 zone)

EMBL: CP002026.PE220

CP002026.PE220       Location/Qualifiers
FT   CDS_pept        complement(211304..212101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0221"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bja:bll6090 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87557"
FT                   /db_xref="GOA:D7A147"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A147"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87557.1"
FT                   /translation="MSDILAGRRRPAGLAYAAVDLAVRFSPVLVLAVFWEFLGLSGIVS
FT                   QQMLPGLMEIFAAFVDMLVNGDLLYNTARSVSRAAAGLGAAVVVGVVVGLMMAQFRAAR
FT                   LLVNPIVQIFYPMPKSALIPVVMIWLGLGDSSKILLIFLGCLLPVVVGTYNGARGVNPF
FT                   LLWSASSLGASRLDVLHEVVLPAAMPDILNGCRTALAFSFILMVSSEFVIATDGVGFMI
FT                   SSLGDGGQYPAMFAAIFFVAGIGFAADRIYAMLARHMLRWREA"
     atgagcgaca tcctcgccgg ccggcgccgc ccggccgggc tcgcctatgc ggccgtcgac        60
     ttggcggtcc gcttctcgcc ggtgctggtg ctggcggtct tctgggagtt cctcggcctc       120
     agcggcatcg tctcgcagca gatgctgccg ggcctgatgg aaatcttcgc cgccttcgtc       180
     gacatgctgg tcaacggcga ccttctctac aacaccgccc gctcggtgag ccgcgcggcc       240
     gccgggctcg gcgcggcggt cgtggtcggc gtggtggtcg ggctgatgat ggcgcagttc       300
     cgcgccgcgc ggctgctggt caatcccatc gtgcagatct tctacccgat gccgaaatcg       360
     gcgctcatcc cggtggtgat gatctggctc gggctcggag attcctcgaa gatcctgctg       420
     atcttccttg gctgcctgct gccggtggtg gtcggcacct ataatggcgc gcgcggggtg       480
     aacccgttcc tgctctggtc ggcttccagc ctcggcgcct cgcgtctcga cgtgctgcac       540
     gaagtcgtgc tgcccgctgc catgcccgac atcctcaacg gctgccgcac cgccctcgcc       600
     ttctccttca tcctgatggt gagctcggaa ttcgtcatcg cgacggacgg cgtcggcttc       660
     atgatcagtt cgctcggcga tggcggacag taccccgcca tgttcgccgc gatcttcttc       720
     gtcgccggca tcggcttcgc cgccgaccgc atctacgcga tgcttgcccg gcacatgctg       780
     cgttggaggg aggcatga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page