(data stored in ACNUC1104 zone)

EMBL: CP002026.PE222

CP002026.PE222       Location/Qualifiers
FT   CDS_pept        complement(212928..213956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0223"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   bja:bll6093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87559"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D7A149"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ADH87559.1"
FT                   /translation="MATRRGALALAAALAALIAVPGAMPAAHADPVKIRIGWSTMPGHL
FT                   IPVLYSKPDILKHYGKSYTVEPIRFRGSSPQITAMAAGEIDMAAFGPLVLALAVTNARL
FT                   DVKVVADIIQDGVDDYHSETFLVRSDSGISKVTDMKGKRVGTNAIGSASDTAIRAMFRK
FT                   NGMRDKRDYTMVEVAFPNIPAMLDEHKIDLGTVLQPMSKQLLATGKYKVLFTSEDAMGP
FT                   SQLVFLAANGKFLEANRQAVLDFFEDHVRAVRWFTDPKNRAEAVKIIANFMQQPPETLS
FT                   HLFTREDYFRDPFMVPNVKSIQESIDIAVDLGLAPAGIKVEPDHVDLSFVKEAQKRIEA
FT                   SQ"
     atggcaacac gacgcggcgc gctggcgctc gcggccgctt tggcggccct catcgcggtc        60
     cccggcgcaa tgccggccgc tcacgccgac ccggtgaaga tccgcatcgg ctggtccacc       120
     atgccggggc atctcatccc ggtgctctac agcaagccgg acatcctgaa gcactacggc       180
     aagagctaca cggtggagcc gatccgcttc cgtggctcct ccccccagat caccgccatg       240
     gcggcgggcg agatcgacat ggccgccttc gggccgctgg tcctcgcgct ggccgtcacc       300
     aatgcccggc tcgacgtgaa ggtcgtggcc gacatcatcc aggacggcgt cgacgactat       360
     cacagcgaga ccttcctggt ccgttcggac tccggcatct cgaaggtgac ggacatgaag       420
     ggcaagcggg tgggcaccaa cgccatcggc tcggcctcgg acaccgccat acgcgccatg       480
     ttccgcaaga acggcatgcg cgacaagcgc gactacacca tggtcgaggt cgccttcccg       540
     aacatcccgg ccatgctgga cgagcacaag atcgacctcg gcaccgtgct gcagcccatg       600
     tcgaagcagt tgctcgccac cggcaagtac aaggtgctgt tcacctccga ggacgccatg       660
     ggtccgtccc agctcgtctt cctggcggcg aacggcaagt tcctcgaagc gaaccgccag       720
     gcggtattgg acttcttcga ggaccatgtg cgcgccgtgc gctggttcac cgatccgaag       780
     aaccgcgccg aggcggtgaa gatcatcgcc aacttcatgc agcagccgcc ggagacgctg       840
     agccacctct tcaccaggga ggactatttc cgcgatccct tcatggtgcc gaacgtgaag       900
     tccatacagg agagcatcga catcgccgtc gatctcggtc tcgcgcctgc cggcatcaag       960
     gtcgagccgg accatgtcga tctgagcttc gtcaaggaag cccagaagcg gatcgaggcc      1020
     agccaatga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page