(data stored in ACNUC1104 zone)

EMBL: CP002026.PE224

CP002026.PE224       Location/Qualifiers
FT   CDS_pept        complement(215042..215974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0225"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   mlo:mll1033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87561"
FT                   /db_xref="GOA:D7A1U5"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1U5"
FT                   /inference="protein motif:PFAM:PF05853"
FT                   /protein_id="ADH87561.1"
FT                   /translation="MAAARKVIITCACTGAIHTPSMSPHLPITPDEIIADAIGAAEAGA
FT                   AILHLHARNPENGRPDQTPEAFGRFLPQIRQQTNAAINITTGGSPYMKVEERVLPAARF
FT                   KPEVASLNMGSINFGLYHLLDRYKEFKFDWERQHLEATRDLVFRNSFKDIEYILETCYD
FT                   NGTRFEFECYDIAHLYNLKHFLDRGLVKPPLFVQSVFGILGGIGTHPEDIIHMKRTADR
FT                   LFGDQYRWSVLGAGASQLRVAAMAASMGANVRVGLEDSLWIGPGELAPSSGAQVRKARQ
FT                   ILEGMGLELASPDEAREILQLKGADRVDF"
     atggctgctg cccgcaaggt catcatcacc tgcgcctgca ccggcgcgat ccacacgcct        60
     tccatgtcgc cgcatctgcc gatcacgccg gacgagatca tcgccgacgc catcggcgcc       120
     gccgaggccg gcgcggcgat cctgcacctg cacgcccgca atccggagaa cggccggccg       180
     gaccagacgc ccgaggcctt cggccggttc ctgccgcaga tccggcagca gaccaatgcc       240
     gccatcaaca tcaccaccgg cggcagcccc tacatgaagg tcgaggagcg ggtgctgccg       300
     gcggcgcggt tcaagccgga ggtggcctcg ttgaacatgg gctcgatcaa tttcggcctc       360
     tatcacctgc tcgaccgcta caaggagttc aagttcgact gggagcgcca gcatctcgaa       420
     gccacgcgcg acctcgtctt ccgcaattcc ttcaaggaca tcgagtacat actcgagacc       480
     tgctacgaca acggcacgcg cttcgagttt gagtgctacg acatcgccca tctctacaat       540
     ctcaagcact tcctcgaccg cggcctcgtc aagccgccgc tcttcgtgca gtcggtgttc       600
     ggcatcctcg gcggcatcgg cacccacccc gaggacatca tccacatgaa gcgcaccgcc       660
     gaccggctgt tcggcgacca gtaccgctgg tcggtgctgg gcgcaggcgc gtcgcaactg       720
     cgcgtcgccg ccatggcggc ctcgatgggc gccaatgtcc gggtcggact ggaggattcg       780
     ctctggatcg ggccgggcga actcgccccg tcgagcggcg cgcaggtgcg caaggcgcgg       840
     cagatcctcg aaggcatggg cctcgaactc gcctcgcccg acgaggcgcg cgagatcctt       900
     cagctcaagg gcgccgacag ggtggacttc tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page