(data stored in ACNUC1104 zone)

EMBL: CP002026.PE229

CP002026.PE229       Location/Qualifiers
FT   CDS_pept        219546..220268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0230"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ara:Arad_12307 short-chain alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87566"
FT                   /db_xref="GOA:D7A1V0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87566.1"
FT                   /translation="MTRLDGKTAVVTGAGRGIGRATALALAQAGAHVVAVARTQADLDQ
FT                   LAREGEGRIEPLAADVRDEDFLARIEAMGDLDILVNNAGGNRPKMMVDVDDETLDWMID
FT                   LNIRSVYRVARAAARAMGEGGVIVNMSSQMGHVGSPRRTVYCMTKHAVEGLTKAMAVEL
FT                   APRGIRVVSIAPTFVVTPMTQGMFEDAEFKRFVYDMVPMNDLPVPEDIAQSILFLVSPG
FT                   ARFITGDSLRVDGGWTAR"
     atgacgaggc tcgacggcaa gaccgcggtg gtgacgggcg ccggccgcgg catcggccgg        60
     gcgacggcgc tcgcgctggc tcaggccggc gcccatgtcg tcgcggtcgc ccgtacccag       120
     gccgatctcg accagctcgc ccgcgaaggc gagggacgga tcgaacctct cgcagccgat       180
     gtgcgcgatg aggacttcct cgcgcggatc gaggcgatgg gcgacctcga cattctcgtc       240
     aacaatgccg gcggcaaccg gccgaagatg atggtggatg tcgacgacga gacgcttgac       300
     tggatgatcg acctcaacat ccgctcggtc taccgcgtcg cccgcgccgc cgcccgggcg       360
     atgggcgagg gcggcgtcat cgtcaacatg tcctcgcaga tgggccatgt cggctcgccc       420
     aggcgcacgg tctactgcat gaccaagcat gcggtggagg ggctgaccaa ggcgatggcg       480
     gtggaactgg cgccgcgcgg catccgtgtc gtctcgatcg caccgacctt tgtggtgacg       540
     ccgatgacgc agggcatgtt cgaggacgcc gagttcaagc gcttcgtcta cgacatggtg       600
     ccgatgaacg acctgccggt gcccgaggac atcgcgcagt cgatcctctt cctcgtctcc       660
     cccggcgccc gcttcatcac cggcgacagc ctcagggtcg acggcggctg gaccgcaaga       720
     tag                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page