(data stored in ACNUC1104 zone)

EMBL: CP002026.PE230

CP002026.PE230       Location/Qualifiers
FT   CDS_pept        221025..221750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0231"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bbt:BBta_3436 putative ABC transporter,
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87567"
FT                   /db_xref="GOA:D7A1V1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87567.1"
FT                   /translation="MSDVSPPPAPVFHARGLSKTYVMGDVEVHALRSVDLDIFEREFVV
FT                   LLGPSGSGKSTLLNILGGLDAPTSGEANWRDHNLVGADDAELTRYRREHVGFVFQFYNL
FT                   IPSLTVLENVALVTEIASHPLNARDALALVGLEHRLDHFPSQLSGGEQQRVAVARAIVK
FT                   SPDVLLCDEPTGALDYETGKVVLAAIVRANQQLGTTTVIITHNAAISGMADRVLRLGGG
FT                   RIVGEERNPRRLSPDEVHW"
     atgtccgacg tcagtccccc gcccgcaccg gtttttcacg cccgtggcct ttccaagacc        60
     tacgtgatgg gcgacgtcga ggtccacgcg ctgcgcagcg tggacctcga tattttcgag       120
     cgggagttcg tggtgctgct ggggccatcc ggatccggca aatcgaccct tctcaacatt       180
     cttggcggcc ttgacgcacc gacctcggga gaggcgaact ggcgcgatca caatctcgtc       240
     ggcgccgatg acgcagagct cacccggtac cggcgcgaac atgttgggtt cgtgttccag       300
     ttctacaacc tcattccaag cttgaccgtc cttgagaacg tcgcgctggt aacagagatc       360
     gccagccacc ctctgaatgc acgcgatgcc cttgcgctgg tcggtctaga gcatcggctc       420
     gatcactttc cgtcccagtt gtcgggtggc gagcagcaac gcgtcgccgt cgcgcgcgcg       480
     atcgtcaaat cgcctgacgt gctgttgtgc gacgagccaa ccggcgcgct cgactacgag       540
     accggcaaag tggtgcttgc cgccatcgtc cgcgcaaacc agcagctcgg caccacgacc       600
     gtcatcatca cccacaatgc tgccatctcg gggatggctg accgggtgct gcgcctcggc       660
     ggcggccgca ttgtcggcga agagaggaat ccgcgccggc tgtcgcctga tgaggtgcac       720
     tggtga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page