(data stored in ACNUC1104 zone)

EMBL: CP002026.PE232

CP002026.PE232       Location/Qualifiers
FT   CDS_pept        224113..225312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0233"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: bbt:BBta_3438 putative secretion protein
FT                   HlyD precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87569"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V3"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADH87569.1"
FT                   /translation="MRITVGRGIGLLLLLIAVAGVVWAVLPRPIPVETSKVTKGHFVAT
FT                   VDDDGNTRIRERYVVAAPLAGRLTRVQLKAGDRASTGDVLASILPSPAPFLDPRSRRES
FT                   QERLGAAEAALERAKAMVERARAQAVQAEQELTRTRTLVERGASTMQALERAELAKRVA
FT                   DRDLRAAAFQLHAAEHELDQARALLAQYSDGAKEIPETWSVTAPITGIVLKVNQESETI
FT                   VQPGTPLLELGDPRDIEIVVDVLSTDAVEIRPGARVTIEHWGGPNALEGRVRRVEPAAF
FT                   TKISTLGVEEQRVNVLIDIVSPPDRWSGLGEAYQVDAKIAVFGLEDATIVPAGALFRRD
FT                   DTWHVFTVENGRAQLTPVVVLRRSARSAAIGSGLVLGQSVIVYPSDRIEAGVSVKTSSK
FT                   "
     atgcggatca cagttggtcg cggcattgga cttcttctgt tgctcatagc tgttgccggc        60
     gtggtgtggg cagtgctgcc ccgccccata cccgttgaga catccaaggt tacaaaagga       120
     catttcgttg ccaccgttga cgacgatggc aatacccgaa ttcgagaacg ctacgtcgtc       180
     gcagcgccgc tggcaggtag gctgacccgg gtgcagctta aagccggaga tcgagcttct       240
     accggggacg tgctggcatc aatccttcca tctccggcgc catttctcga tccgcgcagc       300
     cgccgcgaga gccaggagag gctcggtgcg gcagaagcag cgcttgaacg cgccaaggcc       360
     atggtggaac gagcacgggc gcaagccgtt caggccgaac aggagctaac gcgcacgcgc       420
     acattggtcg aacgcggcgc ttcgacgatg caggccctcg aacgggctga gttagcaaag       480
     cgcgtcgccg atcgagattt gcgcgcagca gcgtttcagc tacatgccgc agagcatgaa       540
     ctcgaccagg cgcgcgcgct tcttgcgcag tatagcgatg gtgccaagga gattcctgag       600
     acttggagcg tcactgctcc catcacgggg atcgtcctga aagtcaacca ggagagcgag       660
     acgattgtcc agcccggcac accactcctt gaactgggag atccgcggga tattgagatc       720
     gtagtcgacg ttctcagtac cgacgcagtg gaaattcgcc ccggcgctcg ggtgacgatt       780
     gaacattggg gtggccccaa cgcactggaa ggaagggtac ggcgcgttga gcctgcggct       840
     ttcacgaaga tttcgacgct cggagtcgag gagcagcgag tcaatgtgtt gatcgatatc       900
     gtctcgccgc ctgatcgatg gtccggtctc ggcgaagcat atcaggttga cgccaagatc       960
     gccgttttcg gtctcgagga cgcaacgata gttcctgccg gtgcgctatt ccgccgtgat      1020
     gacacctggc acgtcttcac tgtcgaaaat ggacgcgctc agctaacgcc ggtcgtcgtc      1080
     ctgcggagat ctgcccgttc ggcagccatc ggctcgggat tggtgcttgg ccaaagtgtc      1140
     atcgtctacc caagcgatcg aattgaagca ggtgttagcg tgaaaacatc ttcaaagtga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page