(data stored in ACNUC1104 zone)

EMBL: CP002026.PE234

CP002026.PE234       Location/Qualifiers
FT   CDS_pept        226180..226566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0235"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="KEGG: mrd:Mrad2831_5927 endoribonuclease L-PSP;
FT                   TIGRFAM: endoribonuclease L-PSP; PFAM: Endoribonuclease
FT                   L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87571"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V5"
FT                   /inference="protein motif:TFAM:TIGR00004"
FT                   /protein_id="ADH87571.1"
FT                   /translation="MTERRLISTPAAPPAAGPYSQAVTAGNLVFVAGQLPLDLSGAVPE
FT                   GVEAQTRQSLANVTAVLDAAGASAASVLKTTVFLKNMNDFAAMNAVYAEVFGTSLPARS
FT                   TIEVARLPRDVLVEIECIALSGQA"
     atgaccgagc gtcgcctgat cagcacccct gccgccccgc ccgccgcggg cccgtattcc        60
     caggccgtca cggccggaaa cctcgtcttc gtcgccggcc agctgccgct cgatctgtcg       120
     ggcgccgtcc ccgagggcgt ggaggcgcag acgcgccagt cgctcgccaa tgtgacggcg       180
     gtgctcgacg ccgctggcgc cagcgccgcg agtgtcctca agacgacggt cttcctcaag       240
     aacatgaacg acttcgcggc gatgaacgcg gtctatgcgg aggtgttcgg aacctcgctg       300
     ccggcccgtt cgaccatcga ggtggcgcgc ctgccgcgcg acgtgcttgt cgagatcgaa       360
     tgcatcgctc tttcgggcca ggcgtga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page