(data stored in ACNUC1104 zone)

EMBL: CP002026.PE235

CP002026.PE235       Location/Qualifiers
FT   CDS_pept        226577..227071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mms:mma_0888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87572"
FT                   /db_xref="GOA:D7A1V6"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V6"
FT                   /inference="similar to AA sequence:KEGG:mma_0888"
FT                   /protein_id="ADH87572.1"
FT                   /translation="MTDWKGGVLLHIHIAPAASYEMEELAEANLVAGRGIEGDRYFLGT
FT                   GTYSPKPDIREVTLIEIEALEALAKNDPPLQQSPITLDPADHRRNLTTRGVPLNHLVGK
FT                   RFRVGETVLRGGRLNFPCKYLEELLGMPVFLPLYNRSGLNCSIETGGIIRPGDPIEPLD
FT                   D"
     atgaccgatt ggaagggcgg cgtcctgctc cacatccaca tcgccccggc cgcctcctac        60
     gagatggagg aactggccga agcaaacctc gtcgccgggc gtggcatcga gggagatcgt       120
     tatttcctcg gcacgggcac ctattctccc aagccggaca ttcgcgaggt cacgctcatc       180
     gagatcgagg cgctggaggc gctggcgaaa aacgatccgc ccctgcaaca gagcccgatc       240
     acgctcgacc cggccgacca tcgccggaac ctgacgacgc gtggcgtccc gctcaatcat       300
     ctggtcggca agagattccg cgtgggtgag acggtgctgc gcggcggccg gctgaacttt       360
     ccctgcaaat atctggaaga actcctcggc atgccggtct tcctgccgct ctacaaccgc       420
     tcgggcctca actgctcgat cgagaccggc ggcatcatcc ggccgggcga ccccatcgag       480
     ccgctggacg actga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page