(data stored in ACNUC1104 zone)

EMBL: CP002026.PE236

CP002026.PE236       Location/Qualifiers
FT   CDS_pept        227078..228031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0237"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; Oxidoreductase FAD-binding domain
FT                   protein; oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   KEGG: mrd:Mrad2831_5925 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87573"
FT                   /db_xref="GOA:D7A1V7"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V7"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ADH87573.1"
FT                   /translation="MTARMIMKLDVAERVDDATDVILVSLRHPRRPALPAWKAGAHIDV
FT                   HLPDGRIRQYSLCGDPADRTRYRIAVKREMAGRGGSAWIHETLAVGDAVHCSAPRNNFA
FT                   LAPQAGRHLFIAGGIGVTPLAALAYEALQRGDAFELHLRARSRRHAPLLAELERAFAGH
FT                   LHLHLDDEAPASLDDILAWFGVTADAHLYFCGPAGLNAAIAAAAERQSWAAERCHTEVF
FT                   QPTLDENFKPEPFDITIASTGQTLRVPADRSALDILRANGFVMPSSCELGVCGACICGY
FT                   RDGTVIHRDSVLSLADRQDKLTPCVSRARVGVTLEL"
     atgaccgctc gcatgatcat gaagctggat gtcgccgagc gcgtcgacga cgcgaccgac        60
     gtcatcctgg tttcgctccg ccatccgcgc cggcccgcgc ttcccgcttg gaaggccggc       120
     gcgcatatcg acgttcacct gccggatggg cgcatccggc agtattcgct ctgcggagat       180
     ccggcggacc gcacgcgcta tcgcatcgcc gtcaagcgcg agatggcggg gaggggcggg       240
     tccgcctgga tccacgagac cctcgccgtc ggcgatgcgg tccactgctc cgcgccgcgc       300
     aacaacttcg cgctggcgcc gcaggcaggg cgccatctgt tcatcgccgg ggggatcggc       360
     gtcaccccgc tggccgcgct cgcatacgag gcgcttcagc gcggcgacgc gttcgaactg       420
     catctgcggg cccgctcgcg gcgtcacgcg ccgcttctgg ccgaactgga acgcgccttc       480
     gcagggcatc tgcacctgca tctcgacgat gaggcgccgg cgtcgctgga tgacatcctc       540
     gcgtggttcg gtgtcacggc ggatgcccat ctctatttct gcggacccgc cgggctgaat       600
     gccgccatcg ctgcggccgc cgagaggcag agctgggccg cagagcgctg tcataccgag       660
     gtgttccagc cgacgctgga cgagaatttc aagcccgagc cgttcgacat cacgattgcc       720
     tcgaccggcc agaccctgcg ggtgcctgcc gatcgctcgg ctctcgacat cctgcgcgcc       780
     aatggcttcg tcatgccgtc gtcctgcgaa ctgggcgtgt gcggcgcctg catctgcggc       840
     tatcgcgacg gcacggtgat tcatcgcgac agcgtgctca gtctcgccga ccggcaggac       900
     aagctcacgc cgtgcgtttc ccgtgcccgg gtgggcgtca cgctggaact gtag             954
//

If you have problems or comments...

PBIL Back to PBIL home page