(data stored in ACNUC1104 zone)

EMBL: CP002026.PE238

CP002026.PE238       Location/Qualifiers
FT   CDS_pept        230297..231139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0240"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: xau:Xaut_4128 UBA/ThiF-type
FT                   NAD/FAD binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87575"
FT                   /db_xref="GOA:D7A1V9"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1V9"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ADH87575.1"
FT                   /translation="MTTTDAPAPARASVFSADEVERYARHLVLAEIGGPGQQKLKKASM
FT                   LVVGAGGLGAPALLYLAAAGVGRLVVIDDDIVSLSNLQRQVIHTTERIGQPKTESAGAL
FT                   VAALNPHVVFEGVDARITADNAMELVSSVDVVIDGSDNFSTRYLVSDACALAGRPLVTA
FT                   ALGRFDATVTTLRPHEKNADGTPNPTYRCLFPEPPPAGTVPTCAEAGILGALAGVAGSL
FT                   VALEAVRAVVGFGEGLVGRLLMIDTMSMRFETLSYGWDPDNPLTGESPTITDLSAHRR"
     atgacgacca ccgacgcccc tgcacccgcc cgcgcctccg tgttctccgc cgacgaggtg        60
     gagcgctatg cgcgccatct cgtgctcgcc gagatcggcg ggccggggca gcagaagctg       120
     aagaaggcct cgatgctggt ggtcggcgcg ggcgggctcg gcgcgccggc gctgctctat       180
     ctcgccgccg ccggcgtcgg ccggctggtg gtgatcgacg acgacatcgt ctcgctgtcg       240
     aacctgcagc ggcaggtgat ccataccacc gagaggatcg gccagccgaa gacggagagc       300
     gccggcgccc tcgtcgcggc gctcaatcca catgtcgtct tcgagggcgt cgacgcccgc       360
     atcaccgccg acaacgcgat ggaactggtc tcctcggtcg acgtggtgat cgacggttcc       420
     gacaattttt caacgcgtta cctcgtctcc gacgcctgcg cgctggccgg caggccgctg       480
     gtgacggcgg cgctcgggcg cttcgacgcg acggtgacga cgctgcgccc gcatgagaag       540
     aatgcggacg gcacgcccaa cccgacctat cgctgcctgt tccccgagcc gccgccggcc       600
     ggcaccgtgc cgacctgcgc cgaggcggga atcctcggcg cgctggccgg cgtcgccggc       660
     tcgctcgtgg cgctggaggc ggtccgcgcc gtggtcggat tcggcgaggg gctggtcggt       720
     cgcctcctga tgatcgacac catgtcgatg cgttttgaga cgctgagcta tggctgggac       780
     ccggacaatc cgctgaccgg cgagagcccc accatcaccg atctgtccgc ccacaggcgg       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page