(data stored in ACNUC1104 zone)

EMBL: CP002026.PE239

CP002026.PE239       Location/Qualifiers
FT   CDS_pept        complement(231200..232201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0241"
FT                   /product="Glyoxylate reductase"
FT                   /EC_number="1.1.1.26"
FT                   /note="KEGG: xau:Xaut_4126 glyoxylate reductase; PFAM:
FT                   D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase catalytic
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87576"
FT                   /db_xref="GOA:D7A1W0"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1W0"
FT                   /inference="protein motif:PRIAM:1.1.1.26"
FT                   /protein_id="ADH87576.1"
FT                   /translation="MARKKPLVVVTRRLPDKIETRMRELFDARLNVDDVPMSQEQLAEA
FT                   MATADVLVPAICDRIDAKVIEAAGPNLKLIANFGNGVDHIDVAAANARGITVTNTPGVL
FT                   TEDTADMTMALILAVPRRLTEGAALITSDDGTWPGWSPMWMLGHRIWGKRLGIIGMGRI
FT                   GQAVARRAKAFGLQIHYHNRRPLPAHIEEDLEATYWDSLDQMLARMDILSVNCPHTPAT
FT                   FHLLSARRLKLIRPDAYIVNTARGEVIDEHALIRMIENGEIAGAGLDVFEREPAVSPKL
FT                   LKLARAGKVVLLPHMGSATVEARVDTGEKVIVNIKAFMDGHRPPDRVLPAML"
     atggctcgca agaagccgct ggtggtcgtg acgcgcaggc tgcccgacaa gatcgaaacc        60
     cgtatgcgcg agctgttcga cgcgcgcctg aacgtcgacg acgtcccgat gtcgcaggag       120
     cagctcgccg aggcgatggc taccgccgac gtgctggtac ccgccatctg cgaccgcatc       180
     gacgcgaaag tgatcgaggc cgccggaccg aatctcaagc tgatcgccaa tttcggcaac       240
     ggcgtcgacc atatcgacgt cgccgccgcc aatgcccgcg gcatcaccgt caccaacacg       300
     cccggcgtcc tcaccgagga caccgccgac atgaccatgg cgctgatcct cgccgtgccg       360
     cgccggctca ccgagggcgc ggcgctgatc accagcgacg acggcacctg gccgggctgg       420
     tcgcccatgt ggatgctcgg gcatcgcatc tggggcaagc gcctcggcat catcggcatg       480
     ggccgcatcg gccaggcggt ggcccgccgg gccaaggcct tcggcctgca gatccactac       540
     cacaaccgcc ggcccctccc cgcccatatc gaggaggatc tggaggcgac ctactgggac       600
     agcctcgacc agatgctggc gcgcatggac atattgtccg tcaactgccc gcacacgccg       660
     gcgaccttcc atctgctctc ggcccggcgg ctgaagctga tccgccccga cgcctatatc       720
     gtcaacaccg cccgcggcga ggtgatcgac gaacatgcgc tgatccgcat gatcgagaac       780
     ggcgagatcg ccggcgccgg gctcgacgtg ttcgagcgcg agccggcagt gagcccgaag       840
     ctgctgaagc tcgcccgcgc cggcaaggtg gtgctgctcc cgcatatggg ttcggcgacc       900
     gtcgaggcgc gcgtcgacac cggcgagaag gtgatcgtca acatcaaggc cttcatggac       960
     ggccaccgcc cgcccgaccg cgtgctcccc gctatgctgt ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page