(data stored in ACNUC1104 zone)

EMBL: CP002026.PE240

CP002026.PE240       Location/Qualifiers
FT   CDS_pept        232410..233045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0242"
FT                   /product="protein of unknown function DUF1058"
FT                   /note="PFAM: protein of unknown function DUF1058; KEGG:
FT                   azc:AZC_0237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87577"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1W1"
FT                   /inference="protein motif:PFAM:PF06347"
FT                   /protein_id="ADH87577.1"
FT                   /translation="MDGLRGRAKLRNWAFGLAAGLLVAGLAAGTLGHAQEEPASGESPG
FT                   ASSGASSGDSSGEAPGAANGPTGRASGLPVPRFVSLKADKVNVRSGPTRDHAVAWVFTR
FT                   AGLPVEITAEFETWRRIRDSDGAEGWVYHSMLSGRRTALVSPWKAGEPTPLYADPDKSS
FT                   AVKAKLEPGVLGKVEHCDGKWCRFFENGFDGFVAQERLWGVYPGEKIE"
     atggacgggc ttcggggcag ggcgaagctg cgaaactggg catttggact ggcggcgggc        60
     ctcttggtag cgggcctggc ggcgggcact ctgggccatg cgcaggagga gcccgcatcg       120
     ggcgaatctc cgggcgcttc ctcgggcgct tcttcgggtg attcctccgg cgaggcgccg       180
     ggcgcggcga acggccccac cgggcgcgcc agcggcctgc cggtgccgcg attcgtcagc       240
     ctcaaggccg acaaggtgaa tgtgcgctcc ggcccgacgc gggaccatgc ggtcgcctgg       300
     gtgttcaccc gcgccggcct gccggtggag atcaccgccg aattcgagac ctggcggcgc       360
     atccgcgatt cggacggcgc cgagggctgg gtctaccatt ccatgctgtc gggccgccgc       420
     accgcgctgg tgagcccctg gaaggccggc gagccgaccc cgctctatgc cgacccggac       480
     aagtcctccg cggtgaaggc gaagctggag cccggcgtgc tcggcaaggt cgagcattgc       540
     gacggcaaat ggtgccgctt cttcgaaaac ggcttcgacg gcttcgtcgc ccaggagcgc       600
     ctgtggggcg tctatcccgg cgagaagatc gagtag                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page