(data stored in ACNUC1104 zone)

EMBL: CP002026.PE242

CP002026.PE242       Location/Qualifiers
FT   CDS_pept        233557..234402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0244"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bja:blr5260 transcriptional
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87579"
FT                   /db_xref="GOA:D7A1W3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1W3"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADH87579.1"
FT                   /translation="MTDRPLDLELVRAFVHVAELSSFTRAAEALGSTQAGVSLRLRKLE
FT                   DRLGRTLLERTPRLVRLTPDGAQFLERARRLLAADRDARLWGAPSVQRLRLGISDHTTG
FT                   DTLPGLLSRLAAVSPEVVFDIRMGFSRVLLDAFDAGELDAIVVRREGDRRAGEMVRQDR
FT                   YGWFAAGEARRGSAPLPLALLAAPCGVRAAATGALDAAGIAWREAFTGGSVSSVAAAVA
FT                   AGLAVAPMAAHLAPAGSVDVGPALGLPALPSAKVMLIARAADAPTRAALCELAAFLRAG
FT                   "
     atgaccgatc gaccactcga tctcgaactc gtgcgtgcct tcgtccatgt ggccgaactc        60
     tcgagcttca ctcgcgcggc cgaggcgttg ggcagcaccc aggccggggt gagcctccgg       120
     ctgcgcaagc tggaggatcg cctgggccgc acgctgctgg aacgcacgcc gcgccttgtg       180
     cgcctcaccc ccgacggtgc ccagtttctg gagcgtgctc gccggctgct ggcggccgac       240
     cgcgacgccc gcctctgggg cgcaccatcc gtgcagcggc tgcggcttgg aatcagcgac       300
     cacaccacgg gtgacacgct tccgggtctg ctgagccgtc tggcggcagt cagccccgag       360
     gtcgtgttcg acatccgcat gggcttttcg cgggtcctgc tcgacgcgtt cgatgccggc       420
     gagctcgatg cgattgtggt gcggcgcgag ggcgaccggc gggcagggga gatggtgcgg       480
     caggaccgct atggctggtt cgcggccggc gaggcgcgca ggggctccgc acccctgccg       540
     ctggcgcttc tggcggcgcc ctgcggcgtg cgggcggcgg cgaccggcgc gctggatgct       600
     gccggcatcg cttggcgcga ggcgtttacc ggcggcagcg tgtcttccgt cgccgccgcg       660
     gtggcggcgg gactggccgt ggcgccaatg gccgcccatc tcgctcccgc cggcagcgtc       720
     gatgtggggc cggcgctagg gctgcccgcc ttgccttcgg ccaaggtgat gctgatcgcc       780
     cgcgccgcgg acgcgccgac gagagccgcg ttgtgcgaac tcgccgcctt ccttcgggcc       840
     ggctga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page