(data stored in ACNUC1104 zone)

EMBL: CP002026.PE243

CP002026.PE243       Location/Qualifiers
FT   CDS_pept        complement(234513..235037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0245"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: xau:Xaut_3845
FT                   ferric uptake regulator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87580"
FT                   /db_xref="GOA:D7A1W4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1W4"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADH87580.1"
FT                   /translation="MNEGFRPHNVAISRVVVEEEPVLPVARLRDSSAARTGCPFHDVRH
FT                   MLRDVGLRPTRQRLALGWLLFAKGDRHVSAEILHEEAIKARFPVSLATVYNTLHQFTEV
FT                   GLLRELAVDGSKTYFDTNPSDHHHFFLEGENNLVDIPSAAVEVERIPEPPEGFEVARID
FT                   VVVRLRPKRRS"
     atgaacgaag gcttccgccc ccataacgtc gcgatttccc gcgtggtcgt cgaggaggaa        60
     cctgtgctgc cggtagcccg gctgcgcgac agttccgccg cccgtaccgg ctgcccgttc       120
     cacgacgtgc gccacatgct gcgcgacgtc ggcctgcgcc ccacccgcca gcgcctcgcg       180
     ctcggctggc tgctcttcgc caagggcgac cgccacgtct cggcggaaat cctgcatgag       240
     gaggcgatca aggcgcgctt cccggtctcg ctcgccaccg tctacaacac gctgcaccag       300
     ttcaccgagg tgggcctgct gcgcgagctc gcggtggacg gctcgaagac ctatttcgac       360
     accaacccct cggaccacca ccacttcttc ctcgagggcg agaacaacct cgtcgacatc       420
     ccgagcgcgg cggtcgaggt cgagcgcatt cccgagccgc cggaaggctt cgaggtcgcc       480
     cgcatcgacg tggtggtgcg cctgcgtccc aagcgccgca gctga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page