(data stored in ACNUC1104 zone)

EMBL: CP002026.PE247

CP002026.PE247       Location/Qualifiers
FT   CDS_pept        complement(238185..239666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0249"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: rhi:NGR_c28580 putative
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87584"
FT                   /db_xref="GOA:D7A1W8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1W8"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADH87584.1"
FT                   /translation="MFSRSPPTPASFTCIDATAAPLDHAGCLCHRPEIGALSRRLGAGL
FT                   SRRGFVAGMAASLAAASLGVPGPARAQAGPNRVLFTNVRLFDGTSGTLREGVSLLVEDK
FT                   IVKAIASGTPAAPEGAQVIDGGGRVLMPGLIDMHWHAMFAALPIHVIATADIGYIFLAA
FT                   AAEAERTLMRGFTTIRDLGGPSFALKQAIDEGLIAGPRIYPCGAMITATGGHADLRPTS
FT                   ELPRAAGTPGATEQSGANAIADGEAEVLLRVREQLLQGASQIKMVGGGGVSSPRSPLDA
FT                   STFTESEMRAAVQAAGDWNTYVASHAYAPQTIRRSLDAGVTCIEHGHLMDEEIAAQMAE
FT                   KGIWLSTQPFLSAEDATPLTGPSRERMLQVFAATRTVYPLAKKHGIKTAFGSDLLFSAV
FT                   LARRQGTMLTHLAEWYSAAEALTMATATNAELLTLSGPRNPYPGTLGVLREGAFADMIL
FT                   VDGNPLEDLSLMADPEAKFLVIMKDGRIHKDTLGR"
     atgttctccc gctccccgcc cacccccgca tccttcacct gcatcgacgc gacggcggcg        60
     ccgctcgatc acgccggctg cctgtgccac cggccggaaa tcggtgcgct gagccggcgg       120
     ctcggcgccg gcctgtcgcg gcgcggtttc gtcgccggca tggcggcctc gctggccgcg       180
     gcctcgctcg gcgtgcccgg gccggcgcgg gcgcaggcgg gaccgaaccg ggtgctcttc       240
     accaatgtcc ggctgttcga cggcacctcg ggcacgctgc gcgagggcgt ctcgctgctc       300
     gtcgaggaca agatcgtcaa ggcgatcgcg tccggcacgc cggccgcgcc ggaaggcgcg       360
     caggtgatcg acggcggcgg ccgggtgctg atgcccggcc tgatcgacat gcactggcat       420
     gcgatgttcg ccgcgctgcc gatccatgtg atcgccaccg ccgacatcgg ctacatcttc       480
     ctcgccgccg cggccgaggc cgagcgcacc ctgatgcgcg gcttcaccac catccgcgac       540
     ctcggagggc cgtccttcgc gctcaagcag gccatcgacg agggcctgat cgccggcccg       600
     cgcatctatc cttgcggcgc catgatcacc gccaccggcg gccatgccga cctgcgcccg       660
     accagcgaat tgccgcgcgc cgccggcacg cccggcgcca ccgagcagtc cggcgccaac       720
     gccatcgccg atggcgaggc cgaggtgctg ctgcgggtgc gcgaacagct cctgcagggc       780
     gcctcgcaga tcaagatggt gggcggcggc ggcgtgtcct cgccgcgcag cccgctcgac       840
     gcctcgacct tcacggaaag cgagatgcgc gcggcggtgc aggcggccgg cgactggaac       900
     acctatgtcg ccagccacgc ctacgcgccg cagaccatcc ggcgctcgct cgatgccggc       960
     gtcacctgca tcgagcacgg ccacctgatg gacgaggaga tcgcagcgca gatggccgag      1020
     aagggcatct ggctcagcac ccagcccttc ctcagcgccg aggatgcgac cccgctcacg      1080
     ggcccgagcc gcgagcggat gctgcaggtg ttcgccgcca cccggaccgt ctatccgctg      1140
     gcgaagaagc acggcatcaa gaccgccttc ggctcggacc tgctgttctc ggccgtgctg      1200
     gcgcggcggc agggcaccat gctgacccat ctcgccgagt ggtacagcgc cgcggaggcg      1260
     ctgacgatgg cgacggcgac caatgccgag ctgctgacgc tgtcggggcc gcgcaacccc      1320
     tatcccggca cgctcggcgt gctcagggaa ggcgccttcg ccgacatgat cctggtcgac      1380
     ggcaatccgc tggaggacct gtcgctgatg gccgacccgg aagcgaagtt cctggtcatc      1440
     atgaaggacg gccgcatcca caaggacacg ctcggccgct ag                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page