(data stored in ACNUC1104 zone)

EMBL: CP002026.PE248

CP002026.PE248       Location/Qualifiers
FT   CDS_pept        complement(240511..241359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0250"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="KEGG: azc:AZC_0138 prephenate dehydratase; PFAM:
FT                   prephenate dehydratase; amino acid-binding ACT domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87585"
FT                   /db_xref="GOA:D7A1W9"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1W9"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ADH87585.1"
FT                   /translation="MTTRRIVFQGEPGANSHIACREVYPDHEAVPCPTFEDAFAALQNG
FT                   EADLGMIPIENSVAGRVADIHHLMPTSGLTIVGEFFLPLSHQLMAVKGATLATVKTVES
FT                   HVMALGQCRNIIRKLGLKPIVDADTAGAARLVAEAGDPTRAAVASRLAAEIYGLDIIAE
FT                   NIEDEAHNTTRFVILAKEGEWAPANNGPTVTTFVFRVRNVPAALYKALGGFATNGVNMT
FT                   KLESYQLDGEFFATQFYADVDGHPDDRALKLALEELSFFSKEVRILGVYPAHPYRIALR
FT                   A"
     atgaccaccc gccgcatcgt tttccagggc gagccggggg cgaattcgca catcgcctgc        60
     cgcgaggtct atcccgacca tgaggcggtg ccctgcccga ccttcgagga cgccttcgcg       120
     gcgctgcaga acggcgaggc cgatctcggc atgatcccga tcgagaactc ggtcgccggc       180
     cgcgtggcgg acatccacca tctgatgccg acctcggggc tgaccatcgt cggcgagttc       240
     ttcctgccgc tgtcgcacca gctcatggcg gtgaagggcg cgacgcttgc cacggtgaag       300
     acggtggaga gccacgtcat ggcgctcggc cagtgccgca acatcatccg caagctcggc       360
     ctcaagccga tcgtcgacgc cgacaccgcc ggcgccgccc gtctcgtcgc cgaagcgggc       420
     gacccgaccc gcgcggcggt ggcctcgcgc ctcgcggcgg agatctacgg gctcgacatc       480
     atcgccgaga acatcgagga cgaggcgcac aacaccacgc gcttcgtcat cctggcgaag       540
     gaaggcgaat gggcgccggc caataacggc ccgaccgtga ccaccttcgt cttccgcgtg       600
     cgcaacgtgc cggcggcgct ctacaaggct ctgggcggct tcgccaccaa cggcgtgaac       660
     atgaccaagc tggaatccta tcagctcgac ggcgagttct tcgccaccca gttctacgcc       720
     gacgtcgacg gccacccgga cgaccgcgcg ctcaagctgg ccctggagga actgtccttc       780
     ttctccaagg aagtgcgcat cctcggcgtc taccccgcgc acccctaccg gattgcgttg       840
     cgggcgtga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page