(data stored in ACNUC1104 zone)

EMBL: CP002026.PE249

CP002026.PE249       Location/Qualifiers
FT   CDS_pept        complement(241370..242125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0251"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="TIGRFAM: 3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase; KEGG: azc:AZC_0137
FT                   3-deoxy-D-manno-octulosonate cytidylyltransferase; PFAM:
FT                   acylneuraminate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87586"
FT                   /db_xref="GOA:D7A1X0"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1X0"
FT                   /inference="protein motif:TFAM:TIGR00466"
FT                   /protein_id="ADH87586.1"
FT                   /translation="MSSQDTLILIPARMASTRLPGKPLADLGGRPMIVEVARRSAAANI
FT                   GRVVVATDDEGVRKAVENAGFAVVMTRADHTTGSDRIFEALGHVDPERRVSRIVNVQGD
FT                   LPTIDPALIRSAVDLLDDPAVDIGTLAAQITVEAERTNPNVVKAVGSPLSPSRLRALYF
FT                   TRATAPYGEGPLFHHIGLYAYRRAALERFVALPPSPLESREKLEQLRALEAGMRIDVAI
FT                   VDTVPLGVDTPEDLERARELLAREAKTAK"
     atgtcctccc aggacacact tattcttatt ccagcccgca tggcttccac gcggctgccg        60
     ggaaagccgc tcgccgatct cggcggccgg ccgatgatcg tcgaggtggc gcggcgttcc       120
     gccgcggcca atatcggccg cgtcgtcgtc gccaccgacg atgaaggcgt gcgcaaggcg       180
     gtggaaaacg ccggattcgc cgtcgtcatg acccgcgccg accacaccac gggctcggac       240
     cgaatcttcg aggcactcgg ccatgtcgac ccggagcgcc gggtgagccg catcgtcaac       300
     gtgcagggcg acctgccgac catcgatccg gcgctgatcc gctccgccgt cgacctgctc       360
     gacgatccgg ccgtcgacat cggcacgctg gcggcgcaga tcacggtcga ggccgagcgc       420
     accaacccga acgtggtgaa ggcggtcggc agcccgctct cgccctcgcg cctgcgcgcg       480
     ctctatttca cccgcgccac tgccccctat ggcgaggggc cgctgttcca ccatatcggc       540
     ctctacgcct atcgccgcgc cgcgctggag cgcttcgtcg ccctgccgcc ctcgccgctg       600
     gagagccgcg agaagctgga acagctgcgc gcgctggaag ccggcatgcg catcgacgtc       660
     gccatcgtcg acaccgtgcc gctcggcgtc gacacgccgg aagacctcga acgcgcgcgg       720
     gagcttctgg cgcgcgaagc caagaccgcc aagtga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page